Property Summary

NCBI Gene PubMed Count 36
PubMed Score 41.07
PubTator Score 22.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.700 1.8e-02
Breast cancer -3.100 5.7e-19
breast carcinoma -1.600 2.2e-37
colon cancer -2.500 2.6e-04
invasive ductal carcinoma -2.500 1.8e-04
lung cancer -2.900 4.9e-06
lung carcinoma 2.700 1.2e-28
malignant mesothelioma -1.400 1.2e-05
medulloblastoma, large-cell -2.600 1.2e-02
osteosarcoma 1.802 1.9e-03
ovarian cancer -4.000 1.9e-07
subependymal giant cell astrocytoma 1.954 7.1e-03

Protein-protein Interaction (9)

Gene RIF (18)

AA Sequence

MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN      1 - 70
DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN     71 - 140
PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL    141 - 210
ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR    211 - 280
GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLD    281 - 350
PSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLR    351 - 420
HGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ                 421 - 477
//

Text Mined References (38)

PMID Year Title