Property Summary

NCBI Gene PubMed Count 295
PubMed Score 1514.75
PubTator Score 803.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 2.7

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia 1.300 4.0e-02
acute quadriplegic myopathy 1.301 2.2e-10
adult high grade glioma 1.500 8.0e-04
astrocytoma 1.100 3.7e-10
Astrocytoma, Pilocytic 1.700 4.4e-07
atypical teratoid / rhabdoid tumor 1.500 1.4e-05
Barrett's esophagus 1.500 1.6e-02
Chronic Lymphocytic Leukemia 1.537 1.2e-03
colon cancer 1.700 6.4e-04
cutaneous lupus erythematosus 1.600 5.1e-04
dermatomyositis 1.600 2.6e-03
ependymoma 1.500 3.8e-02
esophageal adenocarcinoma 1.800 1.8e-02
gastric carcinoma 1.300 4.3e-02
glioblastoma 1.800 3.0e-08
intraductal papillary-mucinous neoplasm ... 1.600 9.2e-03
juvenile dermatomyositis 1.382 5.2e-18
lung cancer -1.300 5.1e-03
lung carcinoma -1.600 2.8e-19
malignant mesothelioma -1.600 2.1e-07
oligodendroglioma 1.100 1.2e-02
osteosarcoma 1.445 2.8e-04
ovarian cancer -1.900 9.2e-06
pancreatic ductal adenocarcinoma liver m... 1.545 8.8e-04
pituitary cancer -1.100 5.3e-03
Polycystic ovary syndrome -1.262 1.4e-02
primitive neuroectodermal tumor 2.100 3.8e-05
subependymal giant cell astrocytoma 3.275 1.0e-03
ulcerative colitis 1.100 5.0e-05

 GWAS Trait (1)

Gene RIF (259)

AA Sequence

MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQDLAPQQRAAPQ      1 - 70
QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCE     71 - 140
EGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCS    141 - 210
LSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQ    211 - 280
PTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVP    281 - 350
FDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED    351 - 420
HLLSSGKFMYLEGNADSAMS                                                      421 - 440
//

Text Mined References (298)

PMID Year Title