Property Summary

NCBI Gene PubMed Count 274
Grant Count 268
R01 Count 131
Funding $34,484,484.13
PubMed Score 1457.48
PubTator Score 803.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14763 O14720 O15508 O15517 O15531 Q6UXM8 Q7Z360 Q9BVE0
Symbols DR5
CD262
KILLER
TRICK2
TRICKB
ZTNFR9
TRAILR2
TRICK2A
TRICK2B
TRAIL-R2
KILLER/DR5

Gene

PDB

1D0G   1D4V   1DU3   4N90   1ZA3   2H9G   3X3F   4I9X   4OD2  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624354 screening 3770 / 0 / 360398 uHTS identification of Caspase-8 TRAIL sensitizers in a luminesence assay
624356 summary 0 / 0 / 0 Summary assay for small molecule Caspase-8 TRAIL sensitizers
651596 screening 1602 / 0 / 638 Single concentration confirmation of Caspase-8 TRAIL sensitizer hits in a luminesence panel assay
652002 confirmatory 0 / 0 / 354 Dose Response confirmation of uHTS hits for a small molecule Caspase-8 TRAIL sensitizers in a luminescence panel assay

Gene RIF (238)

PMID Text
26609227 Circulating TRAIL and DR5 increased in COPD patients and were associated with lung function and systemic inflammation in COPD.
26577955 These results demonstrate that increased apoptosis induced by TRAIL is associated with increased expression of DR5 that is mediated by HBX through NF-kappaB pathway.
26561202 Bee venom inhibits colon cancer cell growth, and these anti-proliferative effects may be related to the induction of apoptosis by activation of DR4 and DR5 and inhibition of NF-kappaB activity.
26510914 Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling.
26458551 Synthetic lipid bilayers displaying the membrane protein ligand Apo2L/TRAIL were used to stimulate death receptor-expressing cells in a modular, scalable format
26418999 mutant genotype (CT+TT) of DR5 (rs1047266) may exert a negative synergistic effect on crohn disease.
26297860 study involving a relatively large sample size showed that TNFRSF10 eQTL SNPs within lncRNAs might influence both hepatocellular carcinoma development and HBV infection
26138346 Studied an array of TRAIL-R1 and TRAIL-R2 specific variants on pancreatic cancer cells.
26063410 Shogaol increased death receptor 5 (DR5) levels. Moreover, knockdown of survivin sensitized colon cancer cells to resistant of TRAIL-induced apoptosis.
26024393 a transcript encoding the death receptor DR5 originates from an ERV9-LTR inserted upstream of the protein coding regions of the TNFRSF10B gene, and it shows an expression pattern similar to GTAp63
More...

AA Sequence

MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQDLAPQQRAAPQ      1 - 70
QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCE     71 - 140
EGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCS    141 - 210
LSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQ    211 - 280
PTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVP    281 - 350
FDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED    351 - 420
HLLSSGKFMYLEGNADSAMS                                                      421 - 440
//

Text Mined References (277)

PMID Year Title
26609227 2015 Increased serum TRAIL and DR5 levels correlated with lung function and inflammation in stable COPD patients.
26577955 2015 The enhanced expression of death receptor 5 (DR5) mediated by HBV X protein through NF-kappaB pathway is associated with cell apoptosis induced by (TNF-? related apoptosis inducing ligand) TRAIL in hepatoma cells.
26561202 2015 Anti-cancer effect of bee venom on colon cancer cell growth by activation of death receptors and inhibition of nuclear factor kappa B.
26510914 2015 Suppression of death receptor 5 enhances cancer cell invasion and metastasis through activation of caspase-8/TRAF2-mediated signaling.
26458551 2015 Membrane display and functional analysis of juxtacrine ligand-receptor signaling.
26418999 2015 [Associations of Crohn's disease with DR4 and DR5 gene polymorphisms].
26297860 2016 Expression quantitative trait loci for TNFRSF10 influence both HBV infection and hepatocellular carcinoma development.
26138346 2015 TRAIL-receptor preferences in pancreatic cancer cells revisited: Both TRAIL-R1 and TRAIL-R2 have a licence to kill.
26063410 2015 Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin.
26024393 2016 Comprehensive identification of genes driven by ERV9-LTRs reveals TNFRSF10B as a re-activatable mediator of testicular cancer cell death.
More...