Property Summary

NCBI Gene PubMed Count 20
PubMed Score 1116.12
PubTator Score 313.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.900 2.4e-04
astrocytic glioma -1.600 3.9e-02
Astrocytoma, Pilocytic -2.300 1.9e-09
atypical teratoid / rhabdoid tumor -2.500 1.4e-08
Breast cancer 1.800 4.8e-11
colon cancer -1.600 3.4e-04
ductal carcinoma in situ 1.400 1.5e-03
ependymoma -3.000 1.2e-02
fibroadenoma 1.100 2.6e-03
glioblastoma -1.500 2.1e-05
group 3 medulloblastoma -2.800 6.8e-06
invasive ductal carcinoma 1.720 9.5e-05
lung adenocarcinoma -2.000 1.8e-07
lung cancer -2.900 8.4e-04
lung carcinoma -4.100 2.3e-23
medulloblastoma, large-cell -2.600 4.7e-07
non-small cell lung cancer -3.261 3.4e-24
ovarian cancer -4.600 6.6e-17
pancreatic cancer 1.400 2.8e-04
pancreatic ductal adenocarcinoma liver m... -3.448 1.9e-02
primitive neuroectodermal tumor -2.100 3.9e-04
subependymal giant cell astrocytoma -1.921 1.9e-02

Gene RIF (11)

AA Sequence

MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR      1 - 70
GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG     71 - 140
VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR    141 - 210
TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR    211 - 280
YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV                                     281 - 317
//

Text Mined References (22)

PMID Year Title