Property Summary

NCBI Gene PubMed Count 20
Grant Count 380
R01 Count 256
Funding $32,145,552.22
PubMed Score 1098.84
PubTator Score 313.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.100 0.029
ependymoma -3.100 0.008
glioblastoma -2.200 0.000
medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -3.448 0.019
non-small cell lung cancer -3.390 0.000
lung cancer -5.000 0.000
colon cancer -1.600 0.000
pancreatic cancer 1.600 0.000
fibroadenoma 1.100 0.003
lung adenocarcinoma -3.400 0.000
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -2.400 0.000
subependymal giant cell astrocytoma -1.925 0.012
invasive ductal carcinoma 2.100 0.003
lung carcinoma -4.100 0.000
Breast cancer 1.800 0.000
ductal carcinoma in situ 1.600 0.001
ovarian cancer -5.200 0.000

Synonym

Accession O14756 O43275 17-beta-HSD 6
Symbols HSE
RODH
SDR9C6

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
25422294 No significant difference was found in genotype or allele distributions of the polymorphisms rs12529 of HSD17B5 and rs898611 of HSD17B6 between patients with PCOS and controls.
24244276 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower.
22114194 17beta-hydroxysteroid dehydrogenase type 6 (17betaHSD6) converts the androgen DHT to the estrogen 3beta-Adiol, and this leads to activation of the ERbeta reporter.
21039282 data suggest that there is no association of HSD17B6 and HSD17B5 variants with the occurrence of polycystic ovary syndrome in the Chinese population
21039282 Observational study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
19837928 These replication data suggest a role for HSD17B6 in polycystic ovary syndrome
19837928 Observational study of gene-disease association. (HuGE Navigator)
17289849 RoDH enzymes are expressed in tissues that have microsomal 3alpha-hydroxysteroid dehydrogenase/epimerase activities
17070195 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR      1 - 70
GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG     71 - 140
VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR    141 - 210
TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR    211 - 280
YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV                                     281 - 317
//

Text Mined References (22)

PMID Year Title
25422294 2015 Association analysis between the polymorphisms of HSD17B5 and HSD17B6 and risk of polycystic ovary syndrome in Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
22114194 2011 Estrogen receptor ? and 17?-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer.
21039282 2010 Polymorphisms of the HSD17B6 and HSD17B5 genes in Chinese women with polycystic ovary syndrome.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
19837928 2009 Independent confirmation of association between metabolic phenotypes of polycystic ovary syndrome and variation in the type 6 17beta-hydroxysteroid dehydrogenase gene.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
More...