Property Summary

NCBI Gene PubMed Count 19
Grant Count 9
R01 Count 6
Funding $505,931.01
PubMed Score 10.62
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma 1.048 0.000
non-small cell lung cancer 1.499 0.000
breast carcinoma 1.600 0.000
interstitial cystitis -2.200 0.000
lung adenocarcinoma 1.700 0.000
spina bifida -1.716 0.033
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.200 0.000

Gene RIF (7)

PMID Text
26873447 that the OVOL1-OVOL2 axis may actively contribute to cell differentiation and proliferation in the hair bulb
26504231 OVOL1 is a regulator of trophoblast progenitor cell fate during human trophoblast development.
26127003 KIF3A and OVOL1 are involved in the development of Atopic dermatitis in the Chinese pediatric population.
25509883 OVOL1 may play an important role in human skin morphogenesis and tumorigenesis.
23278845 Association of KIF3A, but not OVOL1 and ACTL9, with atopic eczema in Italian patients
22737237 Molecular phylogeny of OVOL1, OVOL2 and OVOL3 genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions in humans and other species
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSY      1 - 70
SMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCH     71 - 140
NDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRA    141 - 210
KLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL                 211 - 267
//

Text Mined References (20)

PMID Year Title
26873447 2016 Activation of the OVOL1-OVOL2 Axis in the Hair Bulb and in Pilomatricoma.
26504231 2015 OVO-like 1 regulates progenitor cell fate in human trophoblast development.
26127003 2015 Correlation of KIF3A and OVOL1, but not ACTL9, with atopic dermatitis in Chinese pediatric patients.
25509883 2014 Preferential expression of OVOL1 in inner root sheath of hair, sebaceous gland, eccrine duct and their neoplasms in human skin.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23278845 2013 Association of KIF3A, but not OVOL1 and ACTL9, with atopic eczema in Italian patients.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22737237 2012 Molecular phylogeny of OVOL genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions.
More...