Property Summary

NCBI Gene PubMed Count 1,322
Grant Count 617
R01 Count 370
Funding $136,400,244.37
PubMed Score 3297.47
PubTator Score 3555.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Cancer 2,346 6.4 3.2
Dyskeratosis congenita 24 5.772 2.9
Pulmonary Fibrosis 66 3.941 2.0
Esophagitis 26 3.685 1.8
Adenoma 165 3.083 1.5
Anemia 252 3.063 1.5
Adenocarcinoma 115 2.0
Adenocarcinoma of lung (disorder) 48
Aplastic anemia 18
Aplastic anemia, idiopathic 4
Basal cell carcinoma 29
Bladder Neoplasm 109
Brain cancer 21 2.0
Breast cancer 3,094 2.0
Coronary artery disease 240
Cri-Du-Chat syndrome 16
DYSKERATOSIS CONGENITA, AUTOSOMAL DOMINA... 2 
DYSKERATOSIS CONGENITA, AUTOSOMAL DOMINA... 1 
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESS... 3 
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESS... 1 
Disease Progression 125
Epithelial ovarian cancer 19
Glioma 65
HOYERAAL-HREIDARSSON SYNDROME 6
Idiopathic pulmonary fibrosis 21 5.0
Kidney Diseases 86
Leukemia, Myelocytic, Acute 113
Liver carcinoma 217
Lung Diseases, Interstitial 15
Lung Neoplasms 171
Lymphoid leukemia 69
MELANOMA, CUTANEOUS MALIGNANT, SUSCEPTIB... 1 
Malignant glioma 23 2.0
Malignant neoplasm of breast 63
Malignant neoplasm of lung 16
Malignant neoplasm of pancreas 14
Malignant neoplasm of prostate 67
Mammary Neoplasms 410
Melanoma 261
Myeloid Leukemia, Chronic 22
Neuroblastoma 78
PULMONARY FIBROSIS AND/OR BONE MARROW FA... 1 
Pancreatic Neoplasm 79
Prostate cancer 172 2.0
Prostatic Neoplasms 471
Reperfusion Injury 84
Testicular cancer 24 2.0
Testicular malignant germ cell tumor 4
Thyroid Neoplasm 33
Uterine Cervical Neoplasm 21
adrenocortical carcinoma 1,427
cystic fibrosis 1,665
interstitial lung disease 291 2.0
lung cancer 4,466 2.0
medulloblastoma, large-cell 6,234
non-small cell lung carcinoma 413
ovarian neoplasm 97

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.002
cystic fibrosis -2.800 0.000

Synonym

Accession O14746 O14783 Q2XS35 Q8N6C3 Q8NG38 Q8NG46
Symbols TP2
TRT
CMM9
EST2
TCS1
hTRT
DKCA2
DKCB4
hEST2
PFBMFT1

Gene

PDB

4B18   4MNQ   2BCK  

Gene RIF (1281)

PMID Text
27455559 The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review)
27273963 Review/Meta-analysis: TERT rs2736098 variant may modify the susceptibility to cancer.
27077147 TERT promoter mutations may be a specific marker of the clinically aggressive forms of adrenocortical carcinoma
27064992 the prevalence and clinicopathological associations of BRAF V600E and TERT promoter mutations in Chinese PTC patients
27016301 This study found that hTERT polymorphisms were associated with risk of gastric cancer.
26956036 PPARgamma might inhibit the proliferation and migration of GC cell lines through suppressing the expression of TERT and ENAH
26953344 loss of ARID1A protein expression caused by inactivating mutations reactivates TERT transcriptional activity and confers a survival advantage of tumor cells by maintaining their telomeres.
26913901 Clinical Relevance of Telomere Status and Telomerase Activity in Colorectal Cancer
26892657 telomerase may be involved in the phenomenon of regression, as melanomas with regression are less frequently associated with TERT mutations than melanomas without regression
26887940 Multiple Mechanisms Contribute to the Cell Growth Defects Imparted by Human Telomerase Insertion in Fingers Domain Mutations Associated with Premature Aging Diseases.
More...

AA Sequence

MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPS      1 - 70
FRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLL     71 - 140
LRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREA    141 - 210
GVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAE    211 - 280
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSL    281 - 350
RPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT    351 - 420
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRN    421 - 490
TKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSF    491 - 560
FYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGL    561 - 630
RPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQ    631 - 700
DPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQ    701 - 770
PYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL    771 - 840
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVE    841 - 910
DEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRL    911 - 980
KCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAK    981 - 1050
NAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAAN   1051 - 1120
PALPSDFKTILD                                                             1121 - 1132
//

Text Mined References (1330)

PMID Year Title
27455559 2016 [THE SOMATIC MUTATIONS AND ABERRANT METHYLATION AS POTENTIAL GENETIC MARKERS OF URINARY BLADDER CANCER].
27273963 New evidence of TERT rs2736098 polymorphism and cancer risk: an updated meta-analysis.
27077147 [Telomerase reverse transcriptase (TERT) promoter mutations in the tumors of human endocrine organs: Biological and prognostic value].
27064992 2016 BRAF V600E and TERT Promoter Mutations in Papillary Thyroid Carcinoma in Chinese Patients.
27016301 2016 Polymorphisms in human telomerase reverse transcriptase (hTERT) gene and susceptibility to gastric cancer in a Turkish population: Hospital-based case-control study.
26956036 2016 Constitutive expression of PPAR? inhibits proliferation and migration of gastric cancer cells and down-regulates Wnt/?-Catenin signaling pathway downstream target genes TERT and ENAH.
26953344 2016 Inactivating ARID1A Tumor Suppressor Enhances TERT Transcription and Maintains Telomere Length in Cancer Cells.
26913901 2016 Clinical Relevance of Telomere Status and Telomerase Activity in Colorectal Cancer.
26892657 2016 Lack of TERT promoter mutations in melanomas with extensive regression.
26887940 2016 Multiple Mechanisms Contribute to the Cell Growth Defects Imparted by Human Telomerase Insertion in Fingers Domain Mutations Associated with Premature Aging Diseases.
More...