Property Summary

NCBI Gene PubMed Count 1,322
PubMed Score 3297.47
PubTator Score 3555.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
cystic fibrosis 1670 5.03646097911099E-6
medulloblastoma, large-cell 6234 0.00161355017678676
Disease Target Count Z-score Confidence
Idiopathic pulmonary fibrosis 21 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 6.4 3.2
Esophagitis 26 3.685 1.8
Adenoma 165 3.083 1.5
Anemia 252 3.063 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.002
cystic fibrosis -2.800 0.000

Synonym

Accession O14746 O14783 Q2XS35 Q8N6C3 Q8NG38 Q8NG46
Symbols TP2
TRT
CMM9
EST2
TCS1
hTRT
DKCA2
DKCB4
hEST2
PFBMFT1

Gene

PDB

4B18   4MNQ   2BCK  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (1278)

PMID Text
27455559 The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review)
27273963 Review/Meta-analysis: TERT rs2736098 variant may modify the susceptibility to cancer.
27077147 TERT promoter mutations may be a specific marker of the clinically aggressive forms of adrenocortical carcinoma
27064992 the prevalence and clinicopathological associations of BRAF V600E and TERT promoter mutations in Chinese PTC patients
27016301 This study found that hTERT polymorphisms were associated with risk of gastric cancer.
26956036 PPARgamma might inhibit the proliferation and migration of GC cell lines through suppressing the expression of TERT and ENAH
26953344 loss of ARID1A protein expression caused by inactivating mutations reactivates TERT transcriptional activity and confers a survival advantage of tumor cells by maintaining their telomeres.
26913901 Clinical Relevance of Telomere Status and Telomerase Activity in Colorectal Cancer
26892657 telomerase may be involved in the phenomenon of regression, as melanomas with regression are less frequently associated with TERT mutations than melanomas without regression
26887940 Multiple Mechanisms Contribute to the Cell Growth Defects Imparted by Human Telomerase Insertion in Fingers Domain Mutations Associated with Premature Aging Diseases.
More...

AA Sequence

MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPS      1 - 70
FRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLL     71 - 140
LRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREA    141 - 210
GVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAE    211 - 280
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSL    281 - 350
RPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT    351 - 420
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRN    421 - 490
TKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSF    491 - 560
FYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGL    561 - 630
RPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQ    631 - 700
DPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQ    701 - 770
PYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL    771 - 840
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVE    841 - 910
DEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRL    911 - 980
KCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAK    981 - 1050
NAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAAN   1051 - 1120
PALPSDFKTILD                                                             1121 - 1132
//

Text Mined References (1330)

PMID Year Title
27455559 2016 [THE SOMATIC MUTATIONS AND ABERRANT METHYLATION AS POTENTIAL GENETIC MARKERS OF URINARY BLADDER CANCER].
27273963 New evidence of TERT rs2736098 polymorphism and cancer risk: an updated meta-analysis.
27077147 [Telomerase reverse transcriptase (TERT) promoter mutations in the tumors of human endocrine organs: Biological and prognostic value].
27064992 2016 BRAF V600E and TERT Promoter Mutations in Papillary Thyroid Carcinoma in Chinese Patients.
27016301 2016 Polymorphisms in human telomerase reverse transcriptase (hTERT) gene and susceptibility to gastric cancer in a Turkish population: Hospital-based case-control study.
26956036 2016 Constitutive expression of PPAR? inhibits proliferation and migration of gastric cancer cells and down-regulates Wnt/?-Catenin signaling pathway downstream target genes TERT and ENAH.
26953344 2016 Inactivating ARID1A Tumor Suppressor Enhances TERT Transcription and Maintains Telomere Length in Cancer Cells.
26913901 2016 Clinical Relevance of Telomere Status and Telomerase Activity in Colorectal Cancer.
26892657 2016 Lack of TERT promoter mutations in melanomas with extensive regression.
26887940 2016 Multiple Mechanisms Contribute to the Cell Growth Defects Imparted by Human Telomerase Insertion in Fingers Domain Mutations Associated with Premature Aging Diseases.
More...