Property Summary

NCBI Gene PubMed Count 198
PubMed Score 1295.93
PubTator Score 220.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.577 2.2e-04
atypical teratoid/rhabdoid tumor -1.200 1.5e-04
breast carcinoma 1.100 4.0e-16
ductal carcinoma in situ 1.900 6.4e-03
group 3 medulloblastoma -1.400 1.0e-03
invasive ductal carcinoma 2.900 3.9e-03
non-small cell lung cancer 1.638 2.3e-11
osteosarcoma -1.977 7.0e-04
ovarian cancer -1.800 3.5e-13
ulcerative colitis -1.400 3.5e-06

PDB (19)

Gene RIF (138)

AA Sequence

MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE      1 - 70
THQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREA     71 - 140
DKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGK    141 - 210
QHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALES    211 - 280
PRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSK    281 - 350
KNELFSNL                                                                  351 - 358
//

Text Mined References (215)

PMID Year Title