Property Summary

NCBI Gene PubMed Count 181
Grant Count 320
R01 Count 227
Funding $26,884,682.75
PubMed Score 1180.07
PubTator Score 220.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.977 0.001
group 3 medulloblastoma -1.400 0.001
adrenocortical carcinoma -1.577 0.000
non-small cell lung cancer 1.638 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.900 0.006
invasive ductal carcinoma 2.900 0.004
ulcerative colitis -1.400 0.000
ovarian cancer -1.800 0.000

Synonym

Accession O14745 B3KY21 O43552 Q86WQ5 NHERF-1
Symbols EBP50
NHERF
NHERF1
NHERF-1
NPHLOP2

Gene

PDB

1SGH   4Q3H   1G9O   1GQ4   1GQ5   1I92   2D10   2JXO   2KJD   2KRG   2M0T   2M0U   2M0V   2OZF   4JL7   4LMM   4MPA   4N6X   4PQW  

Gene RIF (125)

PMID Text
26977012 A novel NHERF1 mutation in human breast cancer cells inactivates inhibition of EGFR signaling by NHERF1 promoting disease progression.
26789121 Interaction of ABCB4 with EBP50 through its PDZ-like motif plays a critical role in the regulation of ABCB4 expression and stability at the canalicular plasma membrane.
26531778 Results showed that EBP50 specifically scaffolds the interaction of PTEN with EGFR and enhances the inhibition of PTEN on EGF-induced AKT activation. These results elucidated a novel mechanism regulating EGF-induced AKT signaling.
26491017 activation of the Nherf1-PP1alpha-TAZ pathway in osteoblasts is targeted by histone deacetylase inhibitors
26432781 This study identified alpha-actinin-4 as a novel NHERF1 interaction partner and provided new insights into the regulatory mechanism of the actin cytoskeleton by NHERF1.
26218645 The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells
26142394 autosomal-dominant polycystic kidney disease is associated with a decrease in NHERF1 protein and mRNA levels.
26126066 Nuclear NHERF1 expression is associated with drug resistance in in advanced gastric cancer patients treated with epirubicin/oxaliplatin/capecitabine first line chemotherapy.
25990958 A molecular switch in the scaffold NHERF1 enables misfolded CFTR to evade the peripheral quality control checkpoint.
25789870 deuterium uptake profiles of isolated PDZ1 and PDZ2 were similar to those of full-length EBP50. Interestingly, PDZ1 was more dynamic than PDZ2, and these PDZ domains underwent different conformational changes upon ligand binding
More...

AA Sequence

MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE      1 - 70
THQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREA     71 - 140
DKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGK    141 - 210
QHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALES    211 - 280
PRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSK    281 - 350
KNELFSNL                                                                  351 - 358
//

Text Mined References (198)

PMID Year Title
26977012 2016 A Novel NHERF1 Mutation in Human Breast Cancer Inactivates Inhibition by NHERF1 Protein in EGFR Signaling.
26789121 2016 A PDZ-Like Motif in the Biliary Transporter ABCB4 Interacts with the Scaffold Protein EBP50 and Regulates ABCB4 Cell Surface Expression.
26531778 2016 Ezrin-radixin-moesin-binding phosphoprotein-50 regulates EGF-induced AKT activation through interaction with EGFR and PTEN.
26491017 2015 Histone Deacetylase Inhibitors Target the Leukemic Microenvironment by Enhancing a Nherf1-Protein Phosphatase 1?-TAZ Signaling Pathway in Osteoblasts.
26432781 2016 NHERF1 regulates actin cytoskeleton organization through modulation of ?-actinin-4 stability.
26218645 2015 SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.
26142394 2015 Expression of Na+/H+ exchanger regulatory factor 1 in autosomal-dominant polycystic kidney disease.
26126066 2015 The potential predictive role of nuclear NHERF1 expression in advanced gastric cancer patients treated with epirubicin/oxaliplatin/capecitabine first line chemotherapy.
25990958 2015 A molecular switch in the scaffold NHERF1 enables misfolded CFTR to evade the peripheral quality control checkpoint.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...