Property Summary

NCBI Gene PubMed Count 70
PubMed Score 112.02
PubTator Score 107.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.96252743818373E-12
Pick disease 1893 1.150054075239E-4
posterior fossa group B ependymoma 1530 1.3314376688605E-4
medulloblastoma, large-cell 6234 0.00182766908784343
glioblastoma 5572 0.00226825774061045
pediatric high grade glioma 2712 0.00251453698983162
Disease Target Count Z-score Confidence
Cancer 2346 3.145 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.400 0.002
medulloblastoma, large-cell -1.100 0.002
pediatric high grade glioma -1.100 0.003
posterior fossa group B ependymoma -1.100 0.000
Pick disease -1.400 0.000
ovarian cancer -1.800 0.000

Synonym

Accession O14737 B4DE64 Q53YC9 Q6IB70
Symbols TFAR19

Gene

PANTHER Protein Class (1)

PDB

1YYB   2CRU   2K6B  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (51)

PMID Text
26775586 This review describes what is known about PDCD5 and its cellular functions. [review]
26617773 Endogenous PDCD5 overexpression accelerated multiple myeloma cell apoptosis under dexamethasone treatment.
26433055 Studies indicate that programmed cell death 5 (PDCD5) interacts with the tumor protein p53 (p53) pathway to promote cell apoptosis.
26077467 PDCD5 selectively mediates HDAC3 dissociation from p53, which induces HDAC3 cleavage and ubiquitin-dependent proteasomal degradation. This is a a mechanism for p53 activation via PDCD5-dependent HDAC3 decay under genotoxic stress conditions.
26062895 The results suggest a role of PDCD5 in the regulation of p53 function but unrelated to cell cycle arrest or apoptosis, at least in the cell types investigated.
25881604 PDCD5 expression is negatively correlated with disease progression and stage in ovarian cancer.
25881505 Transgenic mice with systemic overexpression of human PDCD5 were protected from cardiac remodeling.
25603536 These findings uncovered an apoptotic signaling cascade linking YAF2, PDCD5, and TP53 during genotoxic stress responses.
25499082 Findings have uncovered an apoptotic signaling cascade linking PDCD5, OTUD5, and p53 during genotoxic stress responses.
25444898 Authors identified DNAJB1 as a negative regulator of PDCD5-mediated apoptosis and found that the apoptosis network of PDCD5 regulates cancer cell death.
More...

AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV      1 - 70
ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY                    71 - 125
//

Text Mined References (83)

PMID Year Title
26775586 2016 Cellular functions of programmed cell death 5.
26617773 2015 Establishment of stable multiple myeloma cell line with overexpressed PDCD5 and its proapoptosis mechanism.
26433055 2016 PDCD5 functions as a regulator of p53 dynamics in the DNA damage response.
26077467 2015 Programmed cell death 5 mediates HDAC3 decay to promote genotoxic stress response.
26062895 2015 The p53 binding protein PDCD5 is not rate-limiting in DNA damage induced cell death.
25881604 2015 Low programmed cell death 5 expression is a prognostic factor in ovarian cancer.
25881505 2015 PDCD5 protects against cardiac remodeling by regulating autophagy and apoptosis.
25603536 2015 YAF2 promotes TP53-mediated genotoxic stress response via stabilization of PDCD5.
25499082 2015 Deubiquitinase OTUD5 mediates the sequential activation of PDCD5 and p53 in response to genotoxic stress.
25444898 2015 DNAJB1 destabilizes PDCD5 to suppress p53-mediated apoptosis.
More...