Property Summary

NCBI Gene PubMed Count 13
PubMed Score 774.30
PubTator Score 36.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 1.6e-06

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (5)

AA Sequence

MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDML      1 - 70
TDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPA     71 - 140
LFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRA    141 - 210
KKK                                                                       211 - 213
//

Text Mined References (15)

PMID Year Title