Property Summary

NCBI Gene PubMed Count 24
Grant Count 24
R01 Count 14
Funding $4,501,594.34
PubMed Score 246.06
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.500 0.001
osteosarcoma 1.266 0.001
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.400 0.000
Atopic dermatitis -1.100 0.000
intraductal papillary-mucinous neoplasm ... 2.200 0.000
adult high grade glioma -1.400 0.000
spina bifida -1.094 0.041
ulcerative colitis -1.100 0.000
ovarian cancer 1.600 0.000

Gene RIF (16)

PMID Text
26423947 HIV-1 Nef (from strains NA7 and NL4-3 only) directly interacts with ACOT8 in 293T cells and this interaction is mediated by residues in the Nef core domain as shown by FACS-Forster resonance energy transfer (FRET)-based methods
24788990 In summary, lipolytic enzyme ACOT8 is frequently upregulated in HCC clinical specimens. More importantly, ACOT8 silencing leads to inhibition of cell growth in HCC in vitro.
23540296 Acyl-CoA thioesterase 8 is a specific protein related to nodal metastasis and prognosis of lung adenocarcinoma.
22190034 HIV-1 Nef (from strains NA7 and NL4-3 only) directly interacts with ACOT8 in 293T cells and this interaction is mediated by residues in the Nef core domain as shown by FACS-Forster resonance energy transfer (FRET)-based methods
21824805 HIV-1 Nef (from strains NA7 and NL4-3 only) directly interacts with ACOT8 in 293T cells and this interaction is mediated by residues in the Nef core domain as shown by FACS-Forster resonance energy transfer (FRET)-based methods
21824805 HIV-1 Nef (from strains NA7 and NL4-3 only) directly interacts with ACOT8 in 293T cells and this interaction is mediated by residues in the Nef core domain as shown by FACS-Forster resonance energy transfer (FRET)-based methods
17624024 An isoform of long-chain acyl-CoA hydrolase may be responsible for the nafamostat hydrolysis in human liver cytosol.
16335799 SREBP2 modulates brain palmitoyl-coa hydrolase gene transcription.
16141203 ACOT4 and ACOT8 are responsible for the termination of beta-oxidation of dicarboxylic acids of medium-chain length with the concomitant release of the corresponding free acids
10807905 HIV-1 Nef (from strains NA7 and NL4-3 only) directly interacts with ACOT8 in 293T cells and this interaction is mediated by residues in the Nef core domain as shown by FACS-Forster resonance energy transfer (FRET)-based methods
More...

AA Sequence

MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKS      1 - 70
VSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQF     71 - 140
SMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVR    141 - 210
ARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWA    211 - 280
GGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL                                   281 - 319
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24788990 2014 Fatty acid metabolic enzyme acyl-CoA thioesterase 8 promotes the development of hepatocellular carcinoma.
23540296 2013 Acyl-CoA thioesterase 8 is a specific protein related to nodal metastasis and prognosis of lung adenocarcinoma.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
17624024 2007 Nafamostat is hydrolysed by human liver cytosolic long-chain acyl-CoA hydrolase.
16940157 2006 Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
More...