Property Summary

NCBI Gene PubMed Count 24
PubMed Score 31.41
PubTator Score 45.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14732 B0YJ29 Q9UJT3 IMP 2
Symbols

Gene

PANTHER Protein Class (2)

PDB

2CZH   2CZI   2CZK   2DDK   2FVZ  

Gene RIF (18)

PMID Text
23453640 results suggest that genetic variability at rs669838-IMPA2,rs4853694-INPP1, rs1732170-GSK3b and rs11921360-GSK3b genes is associated with a higher risk of attempting suicide in bipolar patients.
21213002 Authors propose that the human myo-inositol monophosphatase 2 interacts with myo-inositol monophosphates in the three-metal-ion bound form, and proceeds the dephosphorylation through the three-metal-ion theory.
20800640 No association is found between IMPA2 gene polymorphisms and bipolar disorder.
20800640 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20153384 The current study did not support a substantial role of the upregulation of IMPase in bipolar disorder, although the lithium-insensitivity trait seen in IMPA2 transgenic mice might represent some aspect relevant to the inositol depletion hypothesis.
19910543 Observational study of gene-disease association. (HuGE Navigator)
19066393 Single nucleotide polymorphism in IMPA2 gene is associated with acute lymphoblastic leukemia.
17388992 Observational study of gene-disease association. (HuGE Navigator)
17388992 data suggest that the genetic variants in the IMPA2 gene are not associated with a risk of febrile seizures in Caucasian patients and patients from various genetic groups are likely to have different genetic causes of febrile seizures
More...

AA Sequence

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR      1 - 70
ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER     71 - 140
LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA    141 - 210
LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI    211 - 280
NYGRDDEK                                                                  281 - 288
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23453640 2013 Genetic variability at IMPA2, INPP1 and GSK3? increases the risk of suicidal behavior in bipolar patients.
21269460 2011 Initial characterization of the human central proteome.
21213002 2011 In silico study on the substrate binding manner in human myo-inositol monophosphatase 2.
20800640 2010 Association analysis between polymorphisms in the myo-inositol monophosphatase 2 (IMPA2) gene and bipolar disorder.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20153384 2010 Behavioral analyses of transgenic mice harboring bipolar disorder candidate genes, IMPA1 and IMPA2.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19066393 2009 Acquired variation outweighs inherited variation in whole genome analysis of methotrexate polyglutamate accumulation in leukemia.
17434096 2007 A genome-wide genotyping study in patients with ischaemic stroke: initial analysis and data release.
More...