Property Summary

NCBI Gene PubMed Count 25
PubMed Score 31.54
PubTator Score 45.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.040 1.7e-02
Breast cancer 1.400 8.3e-05
colon cancer -1.600 9.6e-04
Duchenne muscular dystrophy -1.048 1.1e-04
esophageal adenocarcinoma -1.800 3.3e-02
head and neck cancer -1.100 2.1e-02
intraductal papillary-mucinous adenoma (... -2.200 2.6e-03
intraductal papillary-mucinous carcinoma... -2.100 2.7e-03
intraductal papillary-mucinous neoplasm ... -2.100 1.4e-02
juvenile dermatomyositis -1.023 8.6e-06
malignant mesothelioma 5.800 5.7e-10
nephrosclerosis -1.392 7.2e-03
osteosarcoma -2.170 1.1e-04
ovarian cancer 1.600 1.4e-03
pancreatic cancer -3.400 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.908 3.8e-02
pituitary cancer -3.900 9.9e-15
psoriasis 1.700 4.4e-04
tuberculosis 2.500 9.8e-08
ulcerative colitis -1.200 4.6e-06

Gene RIF (19)

AA Sequence

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR      1 - 70
ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER     71 - 140
LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA    141 - 210
LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI    211 - 280
NYGRDDEK                                                                  281 - 288
//

Text Mined References (27)

PMID Year Title