Property Summary

Ligand Count 1
NCBI Gene PubMed Count 17
PubMed Score 12.40
PubTator Score 9.83

Knowledge Summary

Patent (1,794)

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.138 1.8e-02
colon cancer -1.100 3.9e-03
dermatomyositis -1.200 4.7e-03
ependymoma 1.300 1.3e-06
Gaucher disease type 1 -1.600 1.9e-02
group 4 medulloblastoma 1.500 8.5e-04
hereditary spastic paraplegia -1.019 2.6e-03
intraductal papillary-mucinous adenoma (... 1.200 1.9e-02
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
medulloblastoma, large-cell 1.200 1.2e-04
ovarian cancer -2.400 6.9e-08
spina bifida -2.179 3.8e-02

Gene RIF (6)

AA Sequence

MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVAVAEGPFITGE      1 - 70
NIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDD     71 - 140
PYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARMENFAPEFQVGDGIGMDLKLSNHVFNALKQHA    141 - 210
YSEERRSARLHEKKEHSTAEKAVDPKTRLLMYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDS    211 - 280
KVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVV    281 - 350
LLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVW    351 - 420
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEK    421 - 490
MNEDHVQKNGRKAASFLKDDGDPPLLYDE                                             491 - 519
//

Text Mined References (21)

PMID Year Title