Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $8,411.5
PubMed Score 11.24
PubTator Score 9.83

Knowledge Summary

Patent (1,794)

Expression

  Differential Expression (12)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
25865883 the ectopic expression of RIOK3 or a phosphomimetic MDA5-S828D mutation attenuated MDA5-mediated signaling.
25486436 These findings demonstrate that RIOK3 is necessary for maintaining actin cytoskeletal organisation required for migration and invasion, biological processes that are necessary for hypoxia-driven metastasis.
24807708 Authors found that RIOK3 physically interacts with TBK1 and IRF3 and bridges the functions between TBK1 and IRF3 in the activation of type I interferon pathway.
24018050 Functionally, RIOK3 acts as a SUFU-dependent positive regulator of Hedgehog signaling.
22418843 RioK3 is a novel cytoplasmic component of pre-40S pre-ribosomal particle(s) in human cells, required for normal processing of the 21S pre-rRNA.
19050074 Like RIOK3, PAK4 promotes pancreas ductal cell motility and invasion in pancreatic cancer

AA Sequence

MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVAVAEGPFITGE      1 - 70
NIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDD     71 - 140
PYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARMENFAPEFQVGDGIGMDLKLSNHVFNALKQHA    141 - 210
YSEERRSARLHEKKEHSTAEKAVDPKTRLLMYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDS    211 - 280
KVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVV    281 - 350
LLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVW    351 - 420
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEK    421 - 490
MNEDHVQKNGRKAASFLKDDGDPPLLYDE                                             491 - 519
//

Text Mined References (19)

PMID Year Title
25865883 2015 RIOK3-mediated phosphorylation of MDA5 interferes with its assembly and attenuates the innate immune response.
25486436 2015 Hypoxic regulation of RIOK3 is a major mechanism for cancer cell invasion and metastasis.
24807708 2014 RIOK3 is an adaptor protein required for IRF3-mediated antiviral type I interferon production.
24018050 2013 RIO kinase 3 acts as a SUFU-dependent positive regulator of Hedgehog signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22418843 2012 Human RioK3 is a novel component of cytoplasmic pre-40S pre-ribosomal particles.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
19050074 2008 Genomic alterations link Rho family of GTPases to the highly invasive phenotype of pancreas cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...