Property Summary

NCBI Gene PubMed Count 143
Grant Count 351
R01 Count 280
Funding $26,213,583.2
PubMed Score 541.52
PubTator Score 341.43

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

1C15   1CWW   1CY5   1Z6T   2P1H   2YGS   3J2T   3JBT   3YGS   4RHW  

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
489030 screening 2355 / 0 / 329405 uHTS Fluorescent assay for identification of inhibitors of Apaf-1
489031 screening 1041 / 0 / 330719 uHTS Fluorescent assay for identification of activators of Apaf-1
492945 summary 0 / 0 / 0 Summary assay for inhibitors of Apaf-1
492946 summary 0 / 0 / 0 Summary assay for activators of Apaf-1
504614 screening 469 / 0 / 1375 Single concentration confirmation of uHTS Fluorescent assay for identification of inhibitors of Apaf-1
504615 screening 1 / 0 / 1843 uHTS Fluorescent Interference Counterscreen assay for validation of Inhibitors of Apaf-1
504616 screening 7 / 0 / 977 uHTS Fluorescent Interference Counterscreen assay for validation of Activators of Apaf-1
504617 screening 45 / 0 / 939 Single concentration confirmation of uHTS Fluorescent assay for identification of activators of Apaf-1
588524 confirmatory 444 / 0 / 32 Dose response confirmation of uHTS hits for Apaf-1 in a Fluorescent assay
588538 confirmatory 6 / 0 / 456 Dose Response validation of Inhibitors of Apaf-1 using a Fluorescent Interference Counterscreen assay
More...

Gene RIF (102)

PMID Text
27141571 Renal APAF1 expression is increased in diabetes and diabetic nephropathy.
27021436 miR21 is transferred from cancer-associated adipocytes (CAAs) and fibroblasts (CAFs) to the cancer cells, where it suppresses ovarian cancer apoptosis and confers chemoresistance by binding to its direct novel target, APAF1.
26851285 HDAC inhibitors can induce p53 acetylation at lysine 120, which in turn enhances mitochondrion-mediated apoptosis through transcriptional up-regulation of Apaf-1.
26743285 the markers Ets-1 and APAF-1 relative to p53, Ki-67 and PTEN expression in colon adenomas/polyps, were investigated.
26740177 These results suggest that CED-4 forms a complex with ced-3 mRNA and delivers it to ribosomes for translation.
26290316 Inhibition of Caspase-9 restricted, while Apaf-1 promoted, Chlamydia pneumoniae infection in HEp-2, HeLa, and mouse epithelial fibroblast (MEF) cells.
26183023 NF-kappaB response element, located close to the p53RE#1, mediates APAF1 transcriptional repression by affecting interaction between KAISO and p53
26179084 Different selenium concentrations had varying effects on BAK1 and APAF1 levels. APAF1 may play an important role in the pathogenesis of KBD
26014357 cytochrome c and the WD domains of Apaf-1 interact, with bifurcated salt bridges involved in apoptosome assembly
25895636 The auto-assembly of truncated Apaf1 molecules disappeared after several hours without any enzyme activation.
More...

AA Sequence

MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVS      1 - 70
FYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKL     71 - 140
SKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDE    141 - 210
SFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVV    211 - 280
PVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQF    281 - 350
KRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN    351 - 420
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYH    421 - 490
MASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF    491 - 560
PNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRI    561 - 630
ASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSE    631 - 700
QVNCCHFTNSSHHLLLATGSSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLW    701 - 770
DATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH    771 - 840
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTSSDDQTIRLWE    841 - 910
TKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGD    911 - 980
ENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDF    981 - 1050
RLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPL   1051 - 1120
HELRGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGK   1121 - 1190
MLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE               1191 - 1248
//

Text Mined References (145)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27021436 2016 Exosomal transfer of stroma-derived miR21 confers paclitaxel resistance in ovarian cancer cells through targeting APAF1.
26851285 2016 Acetylation of p53 Protein at Lysine 120 Up-regulates Apaf-1 Protein and Sensitizes the Mitochondrial Apoptotic Pathway.
26743285 2015 Changes in immunoexpression of p53, Ki-67, Ets-1, APAF-1 and PTEN in serrated and conventional colon adenomas.
26740177 2016 CED-4 is an mRNA-binding protein that delivers ced-3 mRNA to ribosomes.
26290316 2015 An epistatic effect of apaf-1 and caspase-9 on chlamydial infection.
26183023 2015 Transcriptional activation of APAF1 by KAISO (ZBTB33) and p53 is attenuated by RelA/p65.
26179084 2016 The Roles of the Interaction of BCL2-Antagonist/Killer 1, Apoptotic Peptidase Activating Factor 1 and Selenium in the Pathogenesis of Kashin-Beck Disease.
26014357 2015 Modeling of interaction between cytochrome c and the WD domains of Apaf-1: bifurcated salt bridges underlying apoptosome assembly.
25895636 2015 Oscillation of apoptosome formation through assembly of truncated Apaf-1.
More...