Property Summary

NCBI Gene PubMed Count 8
PubMed Score 38.55
PubTator Score 20.52

Knowledge Summary

Patent (2,613)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
colon cancer 1475 0.039337467031843
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.705 1.9
Cervical cancer 23 3.085 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
colon cancer 1.100 0.039

Synonym

Accession O14718 A1A4V2 Q7RTS4
Symbols

Gene

RRH

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (2)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)
17167409 Peropsin gene is not a common cause of retinitis pigmentosa or some related retinal degenerations, at least in the set of patients we analyzed.

AA Sequence

MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVT      1 - 70
DIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNT     71 - 140
YIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYY    141 - 210
HVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAP    211 - 280
LFAKSSTFYNPCIYVVANKKFRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI                 281 - 337
//

Text Mined References (9)

PMID Year Title
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17167409 2006 Mutation screening of the peropsin gene, a retinal pigment epithelium specific rhodopsin homolog, in patients with retinitis pigmentosa and allied diseases.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12542842 2003 In silico characterisation and chromosomal localisation of human RRH (peropsin)--implications for opsin evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9275222 1997 Peropsin, a novel visual pigment-like protein located in the apical microvilli of the retinal pigment epithelium.