Property Summary

NCBI Gene PubMed Count 8
PubMed Score 41.72
PubTator Score 20.52

Knowledge Summary

Patent (2,613)

TINX Plot

  Disease (3)

Disease Target Count P-value
colon cancer 1478 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.779 1.9
Cervical cancer 24 3.038 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
colon cancer 1.100 3.9e-02

Gene RIF (2)

AA Sequence

MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVT      1 - 70
DIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNT     71 - 140
YIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYY    141 - 210
HVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAP    211 - 280
LFAKSSTFYNPCIYVVANKKFRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI                 281 - 337
//

Text Mined References (9)

PMID Year Title