Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $1,617,844
PubMed Score 38.55
PubTator Score 20.52

Knowledge Summary

Patent (2,613)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
colon cancer 1.100 0.039

Synonym

Accession O14718 A1A4V2 Q7RTS4
Symbols

Gene

RRH

PANTHER Protein Class (2)

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (2)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)
17167409 Peropsin gene is not a common cause of retinitis pigmentosa or some related retinal degenerations, at least in the set of patients we analyzed.

AA Sequence

MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVT      1 - 70
DIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNT     71 - 140
YIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYY    141 - 210
HVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAP    211 - 280
LFAKSSTFYNPCIYVVANKKFRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI                 281 - 337
//

Text Mined References (9)

PMID Year Title
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17167409 2006 Mutation screening of the peropsin gene, a retinal pigment epithelium specific rhodopsin homolog, in patients with retinitis pigmentosa and allied diseases.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12542842 2003 In silico characterisation and chromosomal localisation of human RRH (peropsin)--implications for opsin evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9275222 1997 Peropsin, a novel visual pigment-like protein located in the apical microvilli of the retinal pigment epithelium.