Property Summary

NCBI Gene PubMed Count 38
PubMed Score 94.90
PubTator Score 48.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.1e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.400 1.1e-09

Gene RIF (18)

AA Sequence

MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSF      1 - 70
DMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENC     71 - 140
GFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKYAMDVENKIQEKNV    141 - 210
EPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLL    211 - 280
DIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIAN    281 - 350
LLGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILYE                                 351 - 391
//

Text Mined References (39)

PMID Year Title