Property Summary

NCBI Gene PubMed Count 36
Grant Count 10
R01 Count 8
Funding $1,458,165.67
PubMed Score 88.20
PubTator Score 48.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000

Gene RIF (17)

PMID Text
25747896 The strong effect of some of the somatic cancer mutations on DNMT2 activity suggests that these mutations have a functional role in tumorigenesis.
22942708 DNMT1, DNMT2 and DNMT3A may play important roles in gastric cancer carcinogenesis.
22591353 Mapped is the tRNA binding site of DNMT2 by systematically mutating surface-exposed lysine and arginine residues to alanine and studying the tRNA methylation activity and binding of the corresponding variants.
20864816 the role of Dnmt2 in stress granules could represent a primitive cellular defense mechanism against viral infection.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20147412 Hepatitis B virus-induced overexpression of DNMTs leads to viral DNA methylation and decreased viral gene expression and also leads to methylation of host CpG islands.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19763880 The expression of DNMT1, DNMT2, DNMT3A and DNMT3B in pediatric acute lymphoblastic leukemia patients, was investigated.
19680556 Observational study of gene-disease association. (HuGE Navigator)
19246518 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSF      1 - 70
DMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENC     71 - 140
GFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKYAMDVENKIQEKNV    141 - 210
EPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLL    211 - 280
DIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIAN    281 - 350
LLGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILYE                                 351 - 391
//

Text Mined References (37)

PMID Year Title
25747896 2015 Somatic cancer mutations in the DNMT2 tRNA methyltransferase alter its catalytic properties.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
22942708 2012 Risk-association of DNA methyltransferases polymorphisms with gastric cancer in the Southern Chinese population.
22591353 2012 Mapping the tRNA binding site on the surface of human DNMT2 methyltransferase.
20864816 2011 The DNA methyltranferase Dnmt2 participates in RNA processing during cellular stress.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20147412 2010 Hepatitis B virus replication induces methylation of both host and viral DNA.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19808971 2009 Azacytidine inhibits RNA methylation at DNMT2 target sites in human cancer cell lines.
More...