Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.78
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 3.3e-04
astrocytic glioma -1.500 2.1e-02
atypical teratoid / rhabdoid tumor -1.200 5.2e-04
cutaneous lupus erythematosus -1.200 6.9e-03
dermatomyositis 1.300 4.9e-03
ductal carcinoma in situ -1.600 2.0e-03
ependymoma -1.800 3.3e-02
gastric carcinoma 1.100 3.1e-02
group 4 medulloblastoma -1.100 1.4e-04
invasive ductal carcinoma -1.600 1.1e-02
medulloblastoma, large-cell -1.200 6.5e-03
ovarian cancer -1.100 1.1e-02
pancreatic cancer 1.300 2.5e-04
Pick disease -1.300 2.3e-04
primary pancreatic ductal adenocarcinoma 1.299 3.0e-03

Gene RIF (13)

AA Sequence

MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGA      1 - 70
IEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIR     71 - 140
MVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP              141 - 200
//

Text Mined References (40)

PMID Year Title