Property Summary

NCBI Gene PubMed Count 32
Grant Count 22
R01 Count 14
Funding $1,033,547.33
PubMed Score 20.17
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 0.021
ependymoma -1.800 0.033
cutaneous lupus erythematosus -1.200 0.007
atypical teratoid / rhabdoid tumor -1.200 0.001
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.003
primary pancreatic ductal adenocarcinoma 1.299 0.003
adult high grade glioma -1.400 0.000
Pick disease -1.300 0.000
gastric carcinoma 1.100 0.031
ductal carcinoma in situ -1.700 0.004
invasive ductal carcinoma -2.400 0.001
ovarian cancer 2.700 0.000
pancreatic cancer 1.300 0.000
dermatomyositis 1.300 0.005

Gene RIF (11)

PMID Text
23695561 The cocrystal structure of ICAP1 in complex with krev interaction trapped protein (KRIT)1 is characterized here.
23317506 The structural basis for KRIT1 antagonized ICAP1-modulated integrin-beta1 activation.
22736399 Annexin A1 is associated with gastric cancer survival and promotes gastric cancer cell invasiveness through the formyl peptide receptor/extracellular signal-regulated kinase/integrin beta-1-binding protein 1 pathway.
20616313 Identify ICAP1 as a novel regulator to prevent excessive sprouting angiogenesis.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18812969 integrin cytoplasmic domain-associated protein-1 alpha (icap1alpha) act concordantly to play a critical role in beta1-integrin-mediated cell proliferation.
17133355 TNF-alpha induced expression of c-IAP1 and c-IAP2 via MAP kinases, but not via NF-kappaB, and that MAP kinases participated in the inhibition of apoptosis by induction of c-IAPs in TNF-alpha-stimulated endothelial cells
15703214 ICAP-1 shuttles between the nucleus and cytoplasm in a beta1 integrin-dependent manner
15166238 beta(1) integrin viability signal in collagen matrices is transduced by focal adhesion kinase
11854171 Integrin-binding protein also interacts with Krit 1 protein, cause of CCM1. (ICAP-1, integrin cytoplasmic domain-associated protein 1)
More...

AA Sequence

MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGA      1 - 70
IEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIR     71 - 140
MVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP              141 - 200
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23695561 2013 Cocrystal structure of the ICAP1 PTB domain in complex with a KRIT1 peptide.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23317506 2013 Mechanism for KRIT1 release of ICAP1-mediated suppression of integrin activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22736399 2012 Annexin A1 is associated with gastric cancer survival and promotes gastric cancer cell invasiveness through the formyl peptide receptor/extracellular signal-regulated kinase/integrin beta-1-binding protein 1 pathway.
21768292 2011 Osteoblast mineralization requires beta1 integrin/ICAP-1-dependent fibronectin deposition.
20616313 2010 Integrin cytoplasmic domain-associated protein-1 attenuates sprouting angiogenesis.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18812969 2008 Krit1 modulates beta 1-integrin-mediated endothelial cell proliferation.
More...