Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.80
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.3106030668158E-7
group 3 medulloblastoma 2254 0.00121785485398106

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.221 0.000
group 3 medulloblastoma 1.100 0.001

Synonym

Accession O14709 B2RAH8 Q86VG0
Symbols P18
VHLaK
ZNF20
ZNF166
ZKSCAN9
ZSCAN41
D3S1363E

Gene

  Ortholog (2)

Species Source
Macaque OMA EggNOG
Cow OMA Inparanoid

Gene RIF (1)

PMID Text
12682018 a novel pVHL-interacting protein that functions as a negative regulator of hypoxia-inducible factor-1a (HIF-1alpha) transactivation; demonstrate that the KRAB-A domain in VHLaK mediates pVHL binding and functions as a transcriptional repression module

AA Sequence

MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEALSRLRELCRRW      1 - 70
LRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEELQKDLDGPAIQVPVLVKDQDT     71 - 140
LQKVVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLT    141 - 210
AQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSH    211 - 280
KGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVSLCERDKKKRTPPEKQGQKWKELGDS    281 - 350
LTFGSAISESLIGTEGKKFYKCDMCCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH    351 - 420
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPYKCNECGKV    421 - 490
FSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDECGKTFAQTTYLIDHQRLH    491 - 560
SAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKIFSSKSNFIDHKRMHSREKPYKCTECGKA    561 - 630
FTQSAYLFDHQRLHNGEKPYECNECGKVFILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLH    631 - 700
NGEKPYECRECGKTFIMSKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRA    701 - 770
FSSNRNLIEHKRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH    771 - 840
TGEKPYACSECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVHQRIHTGEKPYKCNECGKD    841 - 910
FSQNKNLVVHQRMHTGEKPYECDKCRKSFTSKRNLVGHQRIHTGEKPYGCNDCSKVFRQRKNLTVHQKIH    911 - 980
TDEKPCECDVSEKEFSQTSNLHLQQKIHTIEEFSWLQNTNESKIEIQKI                         981 - 1029
//

Text Mined References (7)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12682018 2003 The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9380504 1997 Identification of rapid turnover transcripts overexpressed in thyroid tumors and thyroid cancer cell lines: use of a targeted differential RNA display method to select for mRNA subsets.
8353497 1993 YAC-assisted cloning of transcribed sequences from the human chromosome 3p21 region.
7814019 1995 Positional cloning of cDNAs from the human chromosome 3p21-22 region identifies a clustered organization of zinc-finger genes.