Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.80
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.221 0.000
group 3 medulloblastoma 1.100 0.001

Gene RIF (1)

PMID Text
12682018 a novel pVHL-interacting protein that functions as a negative regulator of hypoxia-inducible factor-1a (HIF-1alpha) transactivation; demonstrate that the KRAB-A domain in VHLaK mediates pVHL binding and functions as a transcriptional repression module

AA Sequence

MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEALSRLRELCRRW      1 - 70
LRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEELQKDLDGPAIQVPVLVKDQDT     71 - 140
LQKVVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLT    141 - 210
AQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSH    211 - 280
KGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVSLCERDKKKRTPPEKQGQKWKELGDS    281 - 350
LTFGSAISESLIGTEGKKFYKCDMCCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH    351 - 420
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPYKCNECGKV    421 - 490
FSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDECGKTFAQTTYLIDHQRLH    491 - 560
SAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKIFSSKSNFIDHKRMHSREKPYKCTECGKA    561 - 630
FTQSAYLFDHQRLHNGEKPYECNECGKVFILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLH    631 - 700
NGEKPYECRECGKTFIMSKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRA    701 - 770
FSSNRNLIEHKRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH    771 - 840
TGEKPYACSECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVHQRIHTGEKPYKCNECGKD    841 - 910
FSQNKNLVVHQRMHTGEKPYECDKCRKSFTSKRNLVGHQRIHTGEKPYGCNDCSKVFRQRKNLTVHQKIH    911 - 980
TDEKPCECDVSEKEFSQTSNLHLQQKIHTIEEFSWLQNTNESKIEIQKI                         981 - 1029
//

Text Mined References (7)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12682018 2003 The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9380504 1997 Identification of rapid turnover transcripts overexpressed in thyroid tumors and thyroid cancer cell lines: use of a targeted differential RNA display method to select for mRNA subsets.
8353497 1993 YAC-assisted cloning of transcribed sequences from the human chromosome 3p21 region.
7814019 1995 Positional cloning of cDNAs from the human chromosome 3p21-22 region identifies a clustered organization of zinc-finger genes.