Property Summary

NCBI Gene PubMed Count 126
Grant Count 153
R01 Count 94
Funding $12,833,675.3
PubMed Score 1099.79
PubTator Score 199.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
psoriasis -1.400 0.000
tuberculosis -3.400 0.000
non-small cell lung cancer 1.463 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.001
invasive ductal carcinoma -1.198 0.023
ulcerative colitis 1.700 0.000
ovarian cancer 1.100 0.009
ileal Crohn's disease 1.853 0.043

Synonym

Accession O14684 O14900 Q5SZC0
Symbols PGES
MPGES
PIG12
PP102
PP1294
MGST-IV
MGST1L1
TP53I12
mPGES-1
MGST1-L1

Gene

PANTHER Protein Class (1)

PDB

3DWW   4AL0   4AL1   4BPM   4WAB   4YK5   4YL0   4YL1   4YL3   5BQG   5BQH   5BQI  

Gene RIF (115)

PMID Text
26560040 Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production
26538827 mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes
26498686 Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines.
26113609 mPGES-1 in prostate cancer controls stemness and amplifies epidermal growth factor receptor-driven oncogenicity
25988363 Data suggest that, in organization of enzymes in post-translational endoplasmic reticulum, mPGES1 is likely co-localized with COX2 (cyclooxygenase-2) within a distance of 14.4 A; mPGES-1 is localized much farther from COX1 (cyclooxygenase-1).
25817443 results demonstrate that mPGES-1 is a target gene of defective mismatch repair in human colorectal cancer, with functional consequence
25620445 we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment
25139833 This study clearly demonstrated that the human COX-2 linked to mPGES-1 is a pathway that, when mediated by the prostaglandin E receptor, is linked to promoting cancer growth in a chronic inflammatory environment
25108236 mPGES-1 expression is positively correlated to hepatitis B virus X protein expression in hepatocellular carcinoma tissue.
24886859 Data indicate that inhibition of lysine-specific demethylase 1 activity prevented IL-1beta-induced histone H3 lysine 9 (H3K9) demethylation at microsomal prostaglandin E synthase 1 (mPGES-1) promoter.
More...

AA Sequence

MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR      1 - 70
AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM     71 - 140
ALQILWEAARHL                                                              141 - 152
//

Text Mined References (129)

PMID Year Title
26560040 2016 Low E-prostanoid 2 receptor levels and deficient induction of the IL-1?/IL-1 type I receptor/COX-2 pathway: Vicious circle in patients with aspirin-exacerbated respiratory disease.
26538827 2015 Downregulation of mPGES-1 Expression via EGR1 Plays an Important Role in Inhibition of Caffeine on PGE2 Synthesis of HBx(+) Hepatocytes.
26498686 2015 Prostaglandins induce early growth response 1 transcription factor mediated microsomal prostaglandin E2 synthase up-regulation for colorectal cancer progression.
26113609 2015 mPGES-1 in prostate cancer controls stemness and amplifies epidermal growth factor receptor-driven oncogenicity.
25988363 2015 Relationship of the Topological Distances and Activities between mPGES-1 and COX-2 versus COX-1: Implications of the Different Post-Translational Endoplasmic Reticulum Organizations of COX-1 and COX-2.
25817443 2015 Instability of a dinucleotide repeat in the 3'-untranslated region (UTR) of the microsomal prostaglandin E synthase-1 (mPGES-1) gene in microsatellite instability-high (MSI-H) colorectal carcinoma.
25620445 2015 DNA methyltransferase inhibition accelerates the immunomodulation and migration of human mesenchymal stem cells.
25139833 2014 Prostaglandin E2 produced by inducible COX-2 and mPGES-1 promoting cancer cell proliferation in vitro and in vivo.
25108236 2014 15d-PGJ? decreases PGE? synthesis in HBx-positive liver cells by interfering EGR1 binding to mPGES-1 promoter.
24886859 2014 Lysine-specific demethylase 1-mediated demethylation of histone H3 lysine 9 contributes to interleukin 1?-induced microsomal prostaglandin E synthase 1 expression in human osteoarthritic chondrocytes.
More...