Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.45
PubTator Score 8.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
COPD 113
medulloblastoma, large-cell 6,234

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.000
COPD -1.100 0.006

Gene RIF (5)

PMID Text
19096915 PIG11 is considered to be a new candidate liver tumour suppressor gene.
17482569 PIG11 protein may play an important role by interaction with other biological molecules in the regulation of apoptosis and provided us a novel angel of view to explore the possible function of PIG11 in vivo.
16170329 Jasmonates can circumvent drug resistance induced by p53 mutations.
15225615 Overexpression of PIG11 could induce cell apoptosis in the low levels and enhanced the apoptotic effects of arsenic trioxide
12883691 PIG11, as a downstream target of p53, is involved in apoptosis of gastric cancer cells

AA Sequence

MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA      1 - 70
VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF     71 - 140
GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA                         141 - 189
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19096915 2009 PIG11 is involved in hepatocellular carcinogenesis and its over-expression promotes Hepg2 cell apoptosis.
17482569 2007 PIG11 protein binds to DNA in sequence-independent manner in vitro.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16170329 2005 Jasmonates induce nonapoptotic death in high-resistance mutant p53-expressing B-lymphoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...