Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.45
PubTator Score 8.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.6e-04
COPD 118 6.3e-03

Expression

  Differential Expression (2)

Disease log2 FC p
COPD -1.100 6.3e-03
medulloblastoma, large-cell 1.400 3.6e-04

Synonym

Accession O14683 Q3ZCS0
Symbols PIG11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA      1 - 70
VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF     71 - 140
GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA                         141 - 189
//

Text Mined References (17)

PMID Year Title