Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 8
Funding $685,266.23
PubMed Score 113.08
PubTator Score 35.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.005
malignant mesothelioma -2.400 0.000
astrocytoma -4.300 0.001
ependymoma -4.200 0.005
oligodendroglioma -3.000 0.000
esophageal adenocarcinoma 1.600 0.029
glioblastoma -2.900 0.001
osteosarcoma 3.230 0.000
atypical teratoid / rhabdoid tumor -2.100 0.036
medulloblastoma, large-cell -3.600 0.008
adrenocortical carcinoma 2.526 0.000
pancreatic ductal adenocarcinoma liver m... 1.947 0.019
colon cancer 1.900 0.002
Parkinson's disease -2.100 0.019
pediatric high grade glioma -1.500 0.021
pilocytic astrocytoma -2.900 0.000
sonic hedgehog group medulloblastoma -2.100 0.047
lung adenocarcinoma 1.400 0.000
Breast cancer 1.300 0.033
invasive ductal carcinoma 1.600 0.036
psoriasis -1.300 0.000
lung carcinoma 1.100 0.000
Pick disease -2.500 0.013
gastric carcinoma 1.700 0.022
ductal carcinoma in situ 2.000 0.001
ulcerative colitis 1.500 0.000
ovarian cancer 2.700 0.000
pituitary cancer -1.200 0.002
pancreatic cancer 1.100 0.003

Gene RIF (5)

PMID Text
19424503 ENC1 functions as a negative regulator of Nrf2 through suppressing Nrf2 protein translation.
18981988 NRP/B mutations impair Nrf2-dependent NQO1 induction in primary brain tumors.
18854154 Knockdown of ectodermal-neural cortex 1 (with BTB-like domain) (ENC1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17875699 NRP/B enhances oxidative stress responses in breast cancer cells via the Nrf2 pathway, identifying a novel role of nuclear matrix protein(s) in oxidative stress responses.
15459180 results suggest that upregulation of ENC-1 contributes to the development of HCL and provides new information on the possible dysregulation of ENC-1 including expression of a novel antisense gene, ENC-1AS

AA Sequence

MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRY      1 - 70
FEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFL     71 - 140
EKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLV    141 - 210
YESAINWISYDLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQND    211 - 280
GVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGS    281 - 350
ENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT    351 - 420
INKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVL    421 - 490
GNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQRCKTLDCYDP    491 - 560
TLDVWNSITTVPYSLIPTAFVSTWKHLPS                                             561 - 589
//

Text Mined References (20)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19424503 2009 Ectodermal-neural cortex 1 down-regulates Nrf2 at the translational level.
18981988 2009 NRP/B mutations impair Nrf2-dependent NQO1 induction in human primary brain tumors.
17875699 2007 The nuclear matrix protein, NRP/B, enhances Nrf2-mediated oxidative stress responses in breast cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15983046 2005 Ubiquitination of Keap1, a BTB-Kelch substrate adaptor protein for Cul3, targets Keap1 for degradation by a proteasome-independent pathway.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459180 2004 Disruption of a novel ectodermal neural cortex 1 antisense gene, ENC-1AS and identification of ENC-1 overexpression in hairy cell leukemia.
More...