Property Summary

Ligand Count 130
NCBI Gene PubMed Count 268
PubMed Score 422.40
PubTator Score 332.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.416 1.1e-06
adrenocortical carcinoma 1.123 2.9e-02
Astrocytoma, Pilocytic 1.200 3.9e-05
atypical teratoid / rhabdoid tumor 1.300 2.2e-04
dermatomyositis 1.500 4.2e-03
Duchenne muscular dystrophy 1.154 6.5e-07
glioblastoma 1.500 2.0e-03
intraductal papillary-mucinous adenoma (... 1.100 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.100 1.7e-02
invasive ductal carcinoma 1.300 1.1e-02
juvenile dermatomyositis 1.509 1.7e-12
lung cancer 1.100 1.2e-03
malignant mesothelioma -1.200 2.4e-06
medulloblastoma 1.100 4.5e-03
medulloblastoma, large-cell 1.400 1.5e-05
Multiple myeloma 1.307 3.7e-02
osteosarcoma 2.409 4.6e-04
ovarian cancer -1.300 3.2e-03
pancreatic cancer 1.100 1.2e-05
pediatric high grade glioma 1.100 2.5e-03
Pick disease -1.100 1.3e-02
primitive neuroectodermal tumor 1.200 4.0e-04
progressive supranuclear palsy -1.400 7.6e-03

Synonym

Accession O14672 B4DU28 Q10742 Q92650 ADAM 10
Symbols RAK
kuz
AD10
AD18
MADM
CD156c
CDw156
HsT18717

Gene

 GWAS Trait (1)

Gene RIF (245)

AA Sequence

MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRH      1 - 70
FNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTRGGTFYVEPA     71 - 140
ERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEEHAANGPELLR    141 - 210
KKRTTSAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTT    211 - 280
ADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLY    281 - 350
SDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR    351 - 420
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQP    421 - 490
EGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQ    491 - 560
VCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGS    561 - 630
PCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICS    631 - 700
VHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR                          701 - 748
//

Text Mined References (281)

PMID Year Title