Property Summary

NCBI Gene PubMed Count 240
PubMed Score 421.81
PubTator Score 332.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.71640964026254E-12
Duchenne muscular dystrophy 602 6.53160560892601E-7
acute quadriplegic myopathy 1157 1.07935456321673E-6
malignant mesothelioma 3163 2.42589946982978E-6
pancreatic cancer 2300 1.24237926080464E-5
medulloblastoma, large-cell 6234 1.51330160183273E-5
pilocytic astrocytoma 3086 4.18882933906696E-5
atypical teratoid / rhabdoid tumor 4369 2.19552946747583E-4
lung cancer 4473 3.98486355736689E-4
primitive neuroectodermal tumor 3031 4.02939020862883E-4
osteosarcoma 7933 4.63310605041483E-4
ovarian cancer 8492 0.00129552223193728
glioblastoma 5572 0.00196334873311424
pediatric high grade glioma 2712 0.0024546791889639
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00269201351803036
dermatomyositis 967 0.00421746139024138
invasive ductal carcinoma 2950 0.0108063047886808
Pick disease 1893 0.012851855371548
sonic hedgehog group medulloblastoma 1482 0.0151728046008906
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0154261972935864
progressive supranuclear palsy 674 0.0158521420851322
adrenocortical carcinoma 1427 0.0286361599138805
Multiple myeloma 1328 0.0369205115746891
Disease Target Count Z-score Confidence
Cancer 2346 3.936 2.0

Expression

Synonym

Accession O14672 B4DU28 Q10742 Q92650 ADAM 10
Symbols RAK
kuz
AD10
AD18
MADM
CD156c
CDw156
HsT18717

Gene

PDB

1M1I  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (216)

PMID Text
26840909 These findings indicate that different mechanisms regulate shear- and ligand-induced shedding and shear forces found within the vasculature can regulate ADAM10 activity.
26757187 The results of this study demonistrated that age-dependent increase in ADAM10 levels and activity in platelets.
26704053 that miR-140-5p suppresses tumor migration and invasion by inhibiting ADAM10-mediated Notch1 signaling pathway
26668317 Data suggest that large extracellular loop of Tspan14 mediates interaction with ADAM10, promotes ADAM10 maturation/trafficking to cell surface, and affects ADAM10 substrate specificity; ADAM10/Tspan14 interact in platelets/vascular endothelial cells.
26422658 The production of ADAM10-positive microvesicles from smoke-exposed neutrophils provides a novel molecular mechanism for the vastly accelerated risk of AAA in smokers.
26359498 established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10
26325204 Serum ADAM10 level was increased in type 1 diabetes and was a significant determinant of circulating cRAGE
26310711 Our findings hinted that overexpression of ADAM10 promotes the progression and migration of nasopharyngeal carcinoma
26296735 ADAM10 activity contributes to house dust mite-induced shedding of chemokines, including CCL20
26283728 The Notch1-dependent enhancement of furin expression increases the activities of MT1-MMP and ADAM10.
More...

AA Sequence

MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRH      1 - 70
FNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTRGGTFYVEPA     71 - 140
ERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEEHAANGPELLR    141 - 210
KKRTTSAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTT    211 - 280
ADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLY    281 - 350
SDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR    351 - 420
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQP    421 - 490
EGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQ    491 - 560
VCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGS    561 - 630
PCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICS    631 - 700
VHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR                          701 - 748
//

Text Mined References (253)

PMID Year Title
26840909 2016 A-Disintegrin-And-Metalloproteinase (ADAM) 10 Activity on Resting and Activated Platelets.
26757187 2016 Increase of ?-Secretase ADAM10 in Platelets Along Cognitively Healthy Aging.
26704053 2016 MicroR-140-5p suppresses tumor cell migration and invasion by targeting ADAM10-mediated Notch1 signaling pathway in hypopharyngeal squamous cell carcinoma.
26686862 2016 TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.
26668317 2016 TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.
26422658 2015 Proteolytically active ADAM10 and ADAM17 carried on membrane microvesicles in human abdominal aortic aneurysms.
26359498 2015 Shedding of Endogenous Interleukin-6 Receptor (IL-6R) Is Governed by A Disintegrin and Metalloproteinase (ADAM) Proteases while a Full-length IL-6R Isoform Localizes to Circulating Microvesicles.
26325204 2015 Serum Level of Soluble Receptor for Advanced Glycation End Products Is Associated with A Disintegrin And Metalloproteinase 10 in Type 1 Diabetes.
26310711 2015 Effects of ADAM10 upregulation on progression, migration, and prognosis of nasopharyngeal carcinoma.
26296735 2015 ADAM10 mediates the house dust mite-induced release of chemokine ligand CCL20 by airway epithelium.
More...