Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.23
PubTator Score 4.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.8e-03
Disease Target Count Z-score Confidence
Ileus 19 3.757 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 4.8e-03

Gene RIF (2)

AA Sequence

MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE      1 - 70
RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ     71 - 140
QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH            141 - 202
//

Text Mined References (10)

PMID Year Title