Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $126,680.43
PubMed Score 3.23
PubTator Score 4.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Disease Z-score Confidence
Ileus 11 3.744 1.9
Schizophrenia 501
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.005

Gene RIF (2)

PMID Text
23873930 Cellular localization and characterization of cytosolic binding partners for Gla domain-containing proteins PRRG4 and PRRG2.
17502622 PRGP2 may be involved in a signal transduction pathway, the impairment of which may be an unintended consequence of warfarin therapy

AA Sequence

MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE      1 - 70
RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ     71 - 140
QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH            141 - 202
//

Text Mined References (10)

PMID Year Title
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23873930 2013 Cellular localization and characterization of cytosolic binding partners for Gla domain-containing proteins PRRG4 and PRRG2.
17502622 2007 Proline-rich Gla protein 2 is a cell-surface vitamin K-dependent protein that binds to the transcriptional coactivator Yes-associated protein.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11171957 2001 Identification of two novel transmembrane gamma-carboxyglutamic acid proteins expressed broadly in fetal and adult tissues.
11042109 2000 Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4.
9256434 1997 Primary structure and tissue distribution of two novel proline-rich gamma-carboxyglutamic acid proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.