Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.21
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 5.6e-03
Down syndrome 1.100 1.2e-03
glioblastoma -1.400 1.2e-02
group 3 medulloblastoma -1.100 3.8e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.3e-03
lung cancer -1.500 1.9e-02
lung carcinoma -1.500 1.4e-18
medulloblastoma, large-cell -1.500 1.3e-04
pancreatic cancer 1.100 6.8e-05
pediatric high grade glioma -1.400 2.6e-03
subependymal giant cell astrocytoma -2.795 6.7e-03

AA Sequence

MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEFWSTYTKAQQG      1 - 70
ESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFD     71 - 140
SSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIVNSNSASAIPM    141 - 210
VPVVTTIK                                                                  211 - 218
//

Text Mined References (10)

PMID Year Title