Property Summary

NCBI Gene PubMed Count 33
Grant Count 8
R01 Count 5
Funding $1,369,105.07
PubMed Score 21.98
PubTator Score 43.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.100 0.024
ependymoma 1.500 0.014
oligodendroglioma 1.400 0.009
psoriasis -1.800 0.000
osteosarcoma 2.232 0.000
atypical teratoid / rhabdoid tumor 1.300 0.001
medulloblastoma, large-cell 1.800 0.000
juvenile dermatomyositis 1.087 0.000
acute quadriplegic myopathy 1.268 0.000
pancreatic ductal adenocarcinoma liver m... 1.107 0.006
group 4 medulloblastoma 1.200 0.035
Pick disease -1.600 0.000
progressive supranuclear palsy -1.100 0.005
ovarian cancer -1.600 0.000

Gene RIF (10)

PMID Text
25843330 STX16 microdeletion was identified in male monozygotic twins (with pseudohypoparathyroidism type 1B leading to growth hormone deficiency) and mother/grandmother (not father/grandfather or sister [their triplet with separate placenta]). [CASE STUDY]
24109596 syntaxin 16 is a key regulator of cytokinesis.
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
23095209 A patient with familial pseudohypoparathyroidism type Ib and his asymptomatic brother were found to have methylation defect at GNAS (guanine nucleotide-binding protein G) and microdeletion involving exons 4-6 of neighboring gene STX16. [CASE REPORT]
23087324 De novo 3-kb STX16 deletions, reported only once previously, are infrequent but should be excluded in all cases of Pseudohypoparathyroidism-Ib, even when the family history is negative for an inherited form of this disorder.
20826815 Results suggest that STX16 mediates recycling of CFTR and constitutes an important component of CFTR trafficking machinery in intestinal epithelial cells.
19887622 phosphorylation of RASSF1A by Aurora B is required for the recruitment of Syntaxin16
17852734 Syntaxin 16 may thus play a role in neurite outgrowth and perhaps other specific dendritic anterograde/retrograde traffic.
17389686 function of syntaxin 16 was specifically required for, and restricted to, the retrograde pathway
15800843 the region of overlap between the two microdeletions likely harbors a cis-acting imprinting control element that is necessary for establishing and methylation at GNAS exon A/B, thus allowing normal G alpha(s) expression in the proximal renal tubules. I

AA Sequence

MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGV      1 - 70
TKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAV     71 - 140
QALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDD    141 - 210
NTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCI    211 - 280
KTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR                             281 - 325
//

Text Mined References (34)

PMID Year Title
25843330 2015 Growth hormone deficiency in monozygotic twins with autosomal dominant pseudohypoparathyroidism type Ib.
25416956 2014 A proteome-scale map of the human interactome network.
24109596 2013 Syntaxin 16 is a master recruitment factor for cytokinesis.
23677696 2013 VAMP4 is required to maintain the ribbon structure of the Golgi apparatus.
23095209 2013 Neuromuscular symptoms in a patient with familial pseudohypoparathyroidism type Ib diagnosed by methylation-specific multiplex ligation-dependent probe amplification.
23087324 2012 De novo STX16 deletions: an infrequent cause of pseudohypoparathyroidism type Ib that should be excluded in sporadic cases.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21223469 2011 The cystic fibrosis transmembrane conductance regulator's expanding SNARE interactome.
21062889 2011 Osteosclerosis in two brothers with autosomal dominant pseudohypoparathyroidism type 1b: bone histomorphometric analysis.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
More...