Property Summary

NCBI Gene PubMed Count 35
PubMed Score 22.39
PubTator Score 43.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Pseudohypoaldosteronism 23 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hyperphosphatemia 32 5.104 2.6
Hypomyelinating leukodystrophy 6 26 3.039 1.5
Disease Target Count
Pseudohypoparathyroidism, Type 1B 5

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.268 6.0e-07
astrocytic glioma 1.100 2.4e-02
atypical teratoid / rhabdoid tumor 1.300 1.4e-03
ependymoma 1.500 1.4e-02
group 4 medulloblastoma 1.200 3.5e-02
juvenile dermatomyositis 1.087 1.2e-11
medulloblastoma, large-cell 1.800 2.6e-05
oligodendroglioma 1.400 8.7e-03
osteosarcoma 1.474 1.9e-04
ovarian cancer -1.200 1.1e-06
pancreatic ductal adenocarcinoma liver m... 1.107 6.0e-03
Pick disease -1.600 1.1e-06
progressive supranuclear palsy -1.100 4.6e-03
psoriasis 1.300 1.0e-02

Protein-protein Interaction (3)

Gene RIF (11)

AA Sequence

MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGV      1 - 70
TKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAV     71 - 140
QALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDD    141 - 210
NTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCI    211 - 280
KTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR                             281 - 325
//

Text Mined References (35)

PMID Year Title