Property Summary

NCBI Gene PubMed Count 174
PubMed Score 1230.69
PubTator Score 760.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 2.000 1.6e-03
non primary Sjogren syndrome sicca 1.100 2.1e-02
osteosarcoma -2.274 1.2e-07
pancreatic ductal adenocarcinoma liver m... -1.079 1.4e-02
psoriasis -2.100 2.3e-05

Protein-protein Interaction (4)

Gene RIF (153)

AA Sequence

MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLF      1 - 70
GQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPH     71 - 140
ASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAG    141 - 210
AERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMC    211 - 280
IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD                      281 - 332
//

Text Mined References (176)

PMID Year Title