Property Summary

NCBI Gene PubMed Count 28
PubMed Score 17.94
PubTator Score 21.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.100 1.9e-05
osteosarcoma 1.448 4.3e-05
ovarian cancer -1.200 4.2e-10

Protein-protein Interaction (5)

Gene RIF (15)

AA Sequence

MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV      1 - 70
DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL     71 - 140
ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY    141 - 210
LT                                                                        211 - 212
//

Text Mined References (30)

PMID Year Title