Property Summary

NCBI Gene PubMed Count 49
Grant Count 73
R01 Count 53
Funding $17,238,015.71
PubMed Score 264.70
PubTator Score 4098.25

Knowledge Summary

Patent (9,414)

Expression

Synonym

Accession O14649 Q53SU2
Symbols OAT1
PPH4
TASK
TBAK1
K2p3.1
TASK-1

Gene

 GWAS Trait (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
602410 screening 2843 / 0 / 337058 Primary cell-based screen for identification of compounds that inhibit the two-pore domain potassium channel KCNK3
602490 summary 0 / 0 / 0 Summary of assays for identification of compounds that inhibit the two-pore domain potassium channel KCNK3
651638 screening 2372 / 0 / 19 Confirmation assay for identification of compounds that inhibit the two-pore domain potassium channel KCNK3 [Primary Screening]
652212 confirmatory 94 / 0 / 4 SAR Analysis for the identification of inhibitors of the two-pore domain potassium channel TASK1 (KCNK3)

Gene RIF (44)

PMID Text
26912814 KCNK3 expression and function were reduced in pulmonary artery smooth muscle cells and endothelial cells in human pulmonary arterial hypertension.
25951834 Enhancement of atrium-selective K(2P)3.1 currents contributes to action potential shortening in atrial fibrillation patients.
25655935 TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes.
25420509 Diacylglycerol mediates regulation of TASK1 and TASK3 potassium channels by GNAQ.
24932805 A glucose-dependent role for beta-cell TASK-1 channels of limiting glucose-stimulated Deltapsip depolarization and insulin secretion, which modulates glucose homeostasis.
24743596 Syntaxin-8 regulates the endocytosis of TASK-1.
24374141 demonstrate the functional importance of ITASK in the atrium and suggest that inactivation of TASK-1 may have diverse effects on atrial size and electrophysiological properties that can contribute to an arrhythmogenic substrate
24035804 HIV-1 Vpu and TASK-1 decrease HIV-1 transcription by suppressing unintegrated HIV-1 DNA, which is inhibited by overexpression of RelA
24015703 Sec61 complex reorientation of the first signal-anchor sequence of TASK-1 determines membrane topology of the other membrane spanning regions.
23883380 Our study identified the association of a novel gene, KCNK3, with familial and idiopathic pulmonary arterial hypertension.
More...

AA Sequence

MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLK      1 - 70
PHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLL     71 - 140
HRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQK    141 - 210
DQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAH    211 - 280
TTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGG    281 - 350
GRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV                              351 - 394
//

Text Mined References (50)

PMID Year Title
26912814 2016 Potassium Channel Subfamily K Member 3 (KCNK3) Contributes to the Development of Pulmonary Arterial Hypertension.
25951834 2015 Upregulation of K(2P)3.1 K+ Current Causes Action Potential Shortening in Patients With Chronic Atrial Fibrillation.
25655935 2015 TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes.
25420509 2014 Diacylglycerol mediates regulation of TASK potassium channels by Gq-coupled receptors.
24932805 2014 Pancreatic ?-cell-specific ablation of TASK-1 channels augments glucose-stimulated calcium entry and insulin secretion, improving glucose tolerance.
24743596 2014 Cooperative endocytosis of the endosomal SNARE protein syntaxin-8 and the potassium channel TASK-1.
24374141 2014 Genetic variation in the two-pore domain potassium channel, TASK-1, may contribute to an atrial substrate for arrhythmogenesis.
24015703 2013 Reorientation of the first signal-anchor sequence during potassium channel biogenesis at the Sec61 complex.
23883380 2013 A novel channelopathy in pulmonary arterial hypertension.
23807092 Acid sensitive background potassium channels K2P3.1 and K2P9.1 undergo rapid dynamin-dependent endocytosis.
More...