Property Summary

NCBI Gene PubMed Count 37
Grant Count 56
R01 Count 42
Funding $6,789,473.49
PubMed Score 133.85
PubTator Score 61.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease -1.200 0.027
malignant mesothelioma 1.400 0.000
glioblastoma 1.300 0.004
group 3 medulloblastoma 1.400 0.026
medulloblastoma, large-cell 1.100 0.003
primitive neuroectodermal tumor 1.600 0.000
Crohn's disease -1.236 0.003
ulcerative colitis -1.629 0.001
adrenocortical carcinoma -1.185 0.001
lung cancer -1.100 0.003
diabetes mellitus -1.300 0.018
pediatric high grade glioma 1.100 0.001
ovarian cancer 1.300 0.000

Synonym

Accession O14646 Q17RZ3 CHD-1
Symbols

Gene

PDB

2B2T   2B2U   2B2V   2B2W   2B2Y   2N39   4B4C   4NW2   4O42   5AFW  

 GO Component (2)

Pathway (1)

Gene RIF (22)

PMID Text
26792750 These results indicate that CHD1 is a positive regulator of influenza virus multiplication and suggest a role for chromatin remodeling in the control of the influenza virus life cycle.
26751641 These data link the assembly of methylated KDM1A and CHD1 with AR-dependent transcription and genomic translocations, thereby providing mechanistic insight into the formation of TMPRSS2-ERG gene fusions during prostate-tumor evolution.
25879624 We have identified CHD1 as the RUNX1 fusion partner in acute myeloid leukemia with t(5;21)(q21;q22).
25770290 identify coordinate loss of MAP3K7 and CHD1 as a unique driver of aggressive prostate cancer development
25297984 CHD1 and CHD2 act as positive regulators of HIV-1 gene expression.
25175909 results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus
24853335 The double chromodomains of CHD1 adopt an 'open pocket' to interact with the free N-terminal amine of H3K4, and the open pocket permits the NS1 mimic to bind in a distinct conformation.
24735615 Data indicate that chromodomain-helicase-DNA-binding protein CHD1, neoplasm protein GREB1 and karyopherin alpha 2 protein KPNA2 as critical mediators of miR-26a and miR-26b elicited cell growth.
23492366 CHD1 is the 5q21 tumor suppressor gene in prostate cancer
22179824 findings suggest that CHD1 deletion may underlie cell invasiveness in a subset of prostate cancers, and indicate a possible novel role of altered chromatin remodeling in prostate tumorigenesis
More...

AA Sequence

MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGSQSESESDTSR      1 - 70
ENKVQAKPPKVDGAEFWKSSPSILAVQRSAILKKQQQQQQQQQHQASSNSGSEEDSSSSEDSDDSSSEVK     71 - 140
RKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETESDYEPKNKVKSRKPQNRSKSKNGKKILGQKK    141 - 210
RQIDSSEEDDDEEDYDNDKRSSRRQATVNVSYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDC    211 - 280
RIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLD    281 - 350
NYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSE    351 - 420
CSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLN    421 - 490
WLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVV    491 - 560
YLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTL    561 - 630
IDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKK    631 - 700
DVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDN    701 - 770
NEFYNKQEALQHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKG    771 - 840
ELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIY    841 - 910
RLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEP    911 - 980
EGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFKVANFSNMDEDDIELEPERNSKNWEEIIPED    981 - 1050
QRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPR   1051 - 1120
ENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERT   1121 - 1190
GGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSN   1191 - 1260
LLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKKEALSGAGSSK   1261 - 1330
RRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRERSKKSSVSDAPVHITASGEPV   1331 - 1400
PISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLEHTRQCLIKIGDHITECLKEYTNPEQ   1401 - 1470
IKQWRKNLWIFVSKFTEFDARKLHKLYKHAIKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSS   1471 - 1540
RDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDH   1541 - 1610
RSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLD   1611 - 1680
QRSPYGSRSPFEHSVEHKSTPEHTWSSRKT                                           1681 - 1710
//

Text Mined References (50)

PMID Year Title
27591891 2016 The Chromatin Remodelling Protein CHD1 Contains a Previously Unrecognised C-Terminal Helical Domain.
26792750 2016 Influenza Virus and Chromatin: Role of the CHD1 Chromatin Remodeler in the Virus Life Cycle.
26751641 2016 Assembly of methylated KDM1A and CHD1 drives androgen receptor-dependent transcription and translocation.
25879624 2015 Transcriptome sequencing reveals CHD1 as a novel fusion partner of RUNX1 in acute myeloid leukemia with t(5;21)(q21;q22).
25770290 2015 Coordinate loss of MAP3K7 and CHD1 promotes aggressive prostate cancer.
25297984 2014 CHD1 and CHD2 are positive regulators of HIV-1 gene expression.
25175909 2014 ERG and CHD1 heterogeneity in prostate cancer: use of confocal microscopy in assessment of microscopic foci.
24853335 2014 Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
24735615 2014 Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...