Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.22
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.400 0.031
posterior fossa group B ependymoma 4.000 0.000
glioblastoma 1.700 0.000
cystic fibrosis -1.683 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
primitive neuroectodermal tumor 1.700 0.013
adrenocortical carcinoma -1.652 0.002
non-small cell lung cancer -2.426 0.000
Hydrolethalus syndrome 1.247 0.006
breast carcinoma 1.200 0.008
fibroadenoma 1.200 0.019
lung adenocarcinoma -1.100 0.000
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.400 0.000
nasopharyngeal carcinoma -2.800 0.000
Pick disease 1.200 0.033
Breast cancer -3.500 0.000
ovarian cancer -1.800 0.001
chronic rhinosinusitis -1.805 0.026

Synonym

Accession O14645 A8K387 B4DHN6 Q05BL9 Q5HYE2 Q5TGH0 Q7L0I5
Symbols P28
hp28
dJ423B22.5

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16990435 ADAP coprecipitates with dynein from activated Jurkat cells, and loss of ADAP prevents microtubule-organizing center (MTOC) translocation and the specific recruitment of dynein to the synapse.

AA Sequence

MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQAEEILN      1 - 70
AILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVT     71 - 140
INCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQ    141 - 210
KAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK                          211 - 258
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23849778 2013 ARMC4 mutations cause primary ciliary dyskinesia with randomization of left/right body asymmetry.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19944400 2009 Deletions and point mutations of LRRC50 cause primary ciliary dyskinesia due to dynein arm defects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16990435 2006 Recruitment of dynein to the Jurkat immunological synapse.
More...