Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.22
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.73036172067032E-21
non-small cell lung cancer 2798 1.15782783911483E-19
lung adenocarcinoma 2714 8.76503146413868E-9
nasopharyngeal carcinoma 1056 1.06549447913542E-8
Breast cancer 3099 7.5747922956804E-8
pilocytic astrocytoma 3086 1.25647944796668E-6
cystic fibrosis 1670 5.85143975156308E-5
adult high grade glioma 2148 1.0524746741739E-4
atypical teratoid/rhabdoid tumor 1095 2.25554802863545E-4
glioblastoma 5572 4.04681083352969E-4
ovarian cancer 8492 0.00123147051343214
adrenocortical carcinoma 1427 0.00240089453381907
Hydrolethalus syndrome 128 0.00622881614668798
breast carcinoma 1614 0.00794706860905146
primitive neuroectodermal tumor 3031 0.012898584143936
fibroadenoma 557 0.0187572439327117
chronic rhinosinusitis 512 0.0262542671398011
astrocytic glioma 2241 0.0311433560285678
Pick disease 1893 0.033123642980312
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 4.382 2.2
Male infertility 170 3.577 1.8

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.400 0.031
posterior fossa group B ependymoma 4.000 0.000
glioblastoma 1.700 0.000
cystic fibrosis -1.683 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
primitive neuroectodermal tumor 1.700 0.013
adrenocortical carcinoma -1.652 0.002
non-small cell lung cancer -2.426 0.000
Hydrolethalus syndrome 1.247 0.006
breast carcinoma 1.200 0.008
fibroadenoma 1.200 0.019
lung adenocarcinoma -1.100 0.000
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.400 0.000
nasopharyngeal carcinoma -2.800 0.000
Pick disease 1.200 0.033
Breast cancer -3.500 0.000
ovarian cancer -1.800 0.001
chronic rhinosinusitis -1.805 0.026

Synonym

Accession O14645 A8K387 B4DHN6 Q05BL9 Q5HYE2 Q5TGH0 Q7L0I5
Symbols P28
hp28
dJ423B22.5

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16990435 ADAP coprecipitates with dynein from activated Jurkat cells, and loss of ADAP prevents microtubule-organizing center (MTOC) translocation and the specific recruitment of dynein to the synapse.

AA Sequence

MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQAEEILN      1 - 70
AILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVT     71 - 140
INCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQ    141 - 210
KAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK                          211 - 258
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23849778 2013 ARMC4 mutations cause primary ciliary dyskinesia with randomization of left/right body asymmetry.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19944400 2009 Deletions and point mutations of LRRC50 cause primary ciliary dyskinesia due to dynein arm defects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16990435 2006 Recruitment of dynein to the Jurkat immunological synapse.
More...