Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.22
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.652 2.4e-03
adult high grade glioma 1.700 1.1e-04
astrocytic glioma 1.400 3.1e-02
Astrocytoma, Pilocytic 1.400 2.3e-06
atypical teratoid / rhabdoid tumor 1.600 2.3e-02
Breast cancer -1.700 3.5e-03
breast carcinoma 1.200 7.9e-03
chronic rhinosinusitis -1.805 2.6e-02
cystic fibrosis -1.683 5.9e-05
ependymoma 3.000 1.1e-02
fibroadenoma 1.200 1.9e-02
glioblastoma 1.600 6.1e-06
Hydrolethalus syndrome 1.247 6.2e-03
lung adenocarcinoma -1.100 8.8e-09
nasopharyngeal carcinoma -2.800 1.1e-08
non-small cell lung cancer -2.426 1.2e-19
ovarian cancer -1.800 1.2e-03
Pick disease 1.200 3.3e-02
primitive neuroectodermal tumor 1.700 1.3e-02

Gene RIF (2)

AA Sequence

MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQAEEILN      1 - 70
AILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVT     71 - 140
INCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQ    141 - 210
KAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK                          211 - 258
//

Text Mined References (18)

PMID Year Title