Property Summary

NCBI Gene PubMed Count 86
PubMed Score 68.41
PubTator Score 50.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 7.6e-08
malignant mesothelioma 3232 7.8e-07
psoriasis 6694 3.1e-05
osteosarcoma 7950 4.0e-05
group 3 medulloblastoma 4104 3.2e-03
oligodendroglioma 2850 7.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.335 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.200 3.2e-03
malignant mesothelioma 1.500 7.8e-07
oligodendroglioma 1.200 7.3e-03
osteosarcoma -1.650 4.0e-05
ovarian cancer -1.100 7.6e-08
psoriasis -1.800 3.1e-05

Gene RIF (48)

AA Sequence

MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEE      1 - 70
ISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNV     71 - 140
SSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGD    141 - 210
SDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGI    211 - 280
SIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLT    281 - 350
VAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH    351 - 420
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRH    421 - 490
TVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHP    491 - 560
YSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGS    561 - 630
LRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG    631 - 700
APPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM                                      701 - 736
//

Text Mined References (95)

PMID Year Title