Property Summary

NCBI Gene PubMed Count 75
Grant Count 28
R01 Count 20
Funding $2,071,391.22
PubMed Score 59.28
PubTator Score 50.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
oligodendroglioma 1.200 0.007
psoriasis -1.800 0.000
osteosarcoma -1.650 0.000
group 3 medulloblastoma 1.200 0.003
ovarian cancer -1.100 0.000

 GO Function (1)

Gene RIF (40)

PMID Text
26013125 In pancreatic cancer cells, AF6 is expressed at reduced levels, causing Dvl2 to be upregulated and available to bind and enhance FOXE1-induced trans-activation of Snail, which promotes proliferation and metastasis.
25871009 Epsins are required for Dishevelled stability and Wnt signalling activation in colon cancer development.
25825496 Dpr1 promotes the ubiquitination of Dvl2 by pVHL and mediates the protein aggregate-elicited autophagy initiation
25622892 APPL1 is a positive regulator of Dvl2-dependent transcriptional activity of AP-1.
25558878 The interaction of Dvl2 with Dapper-1 is involved in the negative regulation of Wnt signaling.
25395054 The data suggest that the expression of DVL2 in colon tissue segments may be important in the pathogenesis of HSCR.
24893630 Elevated DVL2 expression is associated with drug resistance in colorectal cancer.
24727453 these results indicate that RNF185 negatively regulates osteogenesis through the degradation of Dvl2 and down-regulation of canonical Wnt signaling pathway and suggest a possible therapeutic target in osteoporosis.
24616100 IRS1/2 promotes EMT and cell proliferation through stabilizing Dvl2.
24427302 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-beta and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
More...

AA Sequence

MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEE      1 - 70
ISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNV     71 - 140
SSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGD    141 - 210
SDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGI    211 - 280
SIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLT    281 - 350
VAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH    351 - 420
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRH    421 - 490
TVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHP    491 - 560
YSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGS    561 - 630
LRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG    631 - 700
APPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM                                      701 - 736
//

Text Mined References (84)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26013125 2015 Loss of polarity protein AF6 promotes pancreatic cancer metastasis by inducing Snail expression.
25871009 2015 Epsin is required for Dishevelled stability and Wnt signalling activation in colon cancer development.
25825496 2015 The Wnt Signaling Antagonist Dapper1 Accelerates Dishevelled2 Degradation via Promoting Its Ubiquitination and Aggregate-induced Autophagy.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25622892 2015 APPL1 endocytic adaptor as a fine tuner of Dvl2-induced transcription.
25558878 2015 Myc-interacting zinc-finger protein 1 positively regulates Wnt signalling by protecting Dishevelled from Dapper1-mediated degradation.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25395054 2015 Expression patterns of dishevelled-2 in different colon tissue segments in Hirschsprung's disease.
More...