Property Summary

NCBI Gene PubMed Count 81
Grant Count 144
R01 Count 115
Funding $13,104,051.19
PubMed Score 219.75
PubTator Score 53.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.418 0.003
adult high grade glioma -1.100 0.000
spina bifida -1.238 0.042

Synonym

Accession O14640 Q5TA33 Q5TA35 Dishevelled-1
Symbols DVL
DRS2
DVL1L1
DVL1P1

Gene

PANTHER Protein Class (1)

Gene RIF (40)

PMID Text
26924530 Specific -1 frameshift variants in the penultimate exon of DVL1 cause autosomal-dominant Robinow syndrome.
26325443 TMEM88 stimulated triple negative breast cancer cell invasion by interacting with DVLl.
25891077 Data indicate Dishevelled (DVL) as a dual function adaptor to recruit negative regulators ZNRF3/RNF43 to Wnt receptors to ensure proper control of pathway activity.
25817016 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome, with the osteosclerosis possibly the result of an interaction between the wild-type and mutant alleles, leading to elevated canonical Wnt signaling.
25643607 silencing DVL1 sensitized A2780/Taxol cells to paclitaxel, by down-regulating AKT/GSK-3beta/beta-catenin signalling, providing a novel strategy for chemosensitization of ovarian cancer to paclitaxel-induced cytotoxicity.
25436461 Results show that coexpression of IQGAP1 and Dvl in the cytoplasm and nucleus was correlated with the lymph nodal metastase and poor prognosis of non-small cell lung cancer.
25043531 Dvl overexpression may contribute to the malignant proliferation and invasion of human glioma.
24500924 DVL is a master regulator of FZD6/G-protein signaling
24362520 Authors propose a model for Rac1 activation where SIRT1/2 positively modulates the DVL/TIAM1/Rac1 axis and promotes sustained pathway activation.
More...

AA Sequence

MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL      1 - 70
PCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESM     71 - 140
VSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQS    141 - 210
TSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYI    211 - 280
GSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP    281 - 350
RADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR    351 - 420
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFS    421 - 490
EQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSY    491 - 560
GSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSP    561 - 630
RSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM         631 - 695
//

Text Mined References (82)

PMID Year Title
26924530 2016 DVL3 Alleles Resulting in a -1 Frameshift of the Last Exon Mediate Autosomal-Dominant Robinow Syndrome.
26325443 2015 Cytosolic TMEM88 promotes triple-negative breast cancer by interacting with Dvl.
25891077 2015 Dishevelled promotes Wnt receptor degradation through recruitment of ZNRF3/RNF43 E3 ubiquitin ligases.
25817016 2015 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 2015 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25643607 2015 Silencing dishevelled-1 sensitizes paclitaxel-resistant human ovarian cancer cells via AKT/GSK-3?/?-catenin signalling.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25436461 2014 Coexpression of IQ-domain GTPase-activating protein 1 (IQGAP1) and Dishevelled (Dvl) is correlated with poor prognosis in non-small cell lung cancer.
25043531 2014 The expression and significance of dishevelled in human glioma.
More...