Property Summary

NCBI Gene PubMed Count 81
PubMed Score 219.75
PubTator Score 53.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.418 0.003
adult high grade glioma -1.100 0.000
spina bifida -1.238 0.042

Synonym

Accession O14640 Q5TA33 Q5TA35 Dishevelled-1
Symbols DVL
DRS2
DVL1L1
DVL1P1

Gene

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid

Gene RIF (40)

PMID Text
26924530 Specific -1 frameshift variants in the penultimate exon of DVL1 cause autosomal-dominant Robinow syndrome.
26325443 TMEM88 stimulated triple negative breast cancer cell invasion by interacting with DVLl.
25891077 Data indicate Dishevelled (DVL) as a dual function adaptor to recruit negative regulators ZNRF3/RNF43 to Wnt receptors to ensure proper control of pathway activity.
25817016 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome, with the osteosclerosis possibly the result of an interaction between the wild-type and mutant alleles, leading to elevated canonical Wnt signaling.
25643607 silencing DVL1 sensitized A2780/Taxol cells to paclitaxel, by down-regulating AKT/GSK-3beta/beta-catenin signalling, providing a novel strategy for chemosensitization of ovarian cancer to paclitaxel-induced cytotoxicity.
25436461 Results show that coexpression of IQGAP1 and Dvl in the cytoplasm and nucleus was correlated with the lymph nodal metastase and poor prognosis of non-small cell lung cancer.
25043531 Dvl overexpression may contribute to the malignant proliferation and invasion of human glioma.
24500924 DVL is a master regulator of FZD6/G-protein signaling
24362520 Authors propose a model for Rac1 activation where SIRT1/2 positively modulates the DVL/TIAM1/Rac1 axis and promotes sustained pathway activation.
More...

AA Sequence

MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL      1 - 70
PCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESM     71 - 140
VSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQS    141 - 210
TSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYI    211 - 280
GSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP    281 - 350
RADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR    351 - 420
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFS    421 - 490
EQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSY    491 - 560
GSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSP    561 - 630
RSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM         631 - 695
//

Text Mined References (82)

PMID Year Title
26924530 2016 DVL3 Alleles Resulting in a -1 Frameshift of the Last Exon Mediate Autosomal-Dominant Robinow Syndrome.
26325443 2015 Cytosolic TMEM88 promotes triple-negative breast cancer by interacting with Dvl.
25891077 2015 Dishevelled promotes Wnt receptor degradation through recruitment of ZNRF3/RNF43 E3 ubiquitin ligases.
25817016 2015 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 2015 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25643607 2015 Silencing dishevelled-1 sensitizes paclitaxel-resistant human ovarian cancer cells via AKT/GSK-3?/?-catenin signalling.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25436461 2014 Coexpression of IQ-domain GTPase-activating protein 1 (IQGAP1) and Dishevelled (Dvl) is correlated with poor prognosis in non-small cell lung cancer.
25043531 2014 The expression and significance of dishevelled in human glioma.
More...