Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.88
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.262 4.1e-05
adrenocortical carcinoma -3.001 5.5e-05
astrocytoma 1.200 4.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.785 3.2e-04
Breast cancer 1.700 5.0e-02
breast carcinoma -1.500 3.4e-07
Common variable immunodeficiency -1.002 6.4e-03
cystic fibrosis -2.474 2.0e-07
ductal carcinoma in situ -1.300 2.9e-03
fascioscapulohumeral muscular dystrophy 1.504 1.1e-04
glioblastoma -1.400 3.5e-02
interstitial cystitis -1.200 6.8e-05
intraductal papillary-mucinous adenoma (... 2.600 4.2e-04
intraductal papillary-mucinous carcinoma... 2.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.5e-02
invasive ductal carcinoma -1.479 7.2e-04
limb girdle muscular dystrophy 2A 1.151 1.3e-04
lung adenocarcinoma -1.400 3.6e-16
lung carcinoma -1.500 3.1e-13
malignant mesothelioma 2.900 6.9e-08
medulloblastoma -1.200 1.1e-02
medulloblastoma, large-cell -1.100 4.8e-02
nasopharyngeal carcinoma -1.400 3.6e-04
osteosarcoma -2.283 2.0e-03
ovarian cancer -1.800 4.7e-04
pediatric high grade glioma -1.100 7.7e-03
psoriasis 1.300 3.2e-06
spina bifida -2.040 3.7e-02
subependymal giant cell astrocytoma -1.377 3.5e-02
tuberculosis -1.200 3.0e-04
Waldenstrons macroglobulinemia -1.364 3.0e-02

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHLLYLCPKDYCP      1 - 70
RGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIK     71 - 140
NGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA    141 - 210
QPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGL    211 - 280
FGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTR    281 - 350
TSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER    351 - 420
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNS    421 - 490
PLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSE    491 - 560
TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRER    561 - 630
SSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMR    631 - 700
MDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRND    701 - 770
MKKKAKLF                                                                  771 - 778
//

Text Mined References (42)

PMID Year Title