Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 4
Funding $174,064.33
PubMed Score 10.77
PubTator Score 8.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25403273 Exon 11 inclusion isoform of ABLIM1 may have a muscle-specific function, and its abnormal splicing could be related to muscle symptoms of myotonic dystrophy type 1.
21547531 SNP rs727532 in ABLIM1 (10q25) had significant association in the multivariate test & strong associations with novelty seeking, harm avoidance, reward dependence and alcohol dependence in the COGA sample.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHLLYLCPKDYCP      1 - 70
RGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIK     71 - 140
NGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA    141 - 210
QPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGL    211 - 280
FGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTR    281 - 350
TSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER    351 - 420
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNS    421 - 490
PLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSE    491 - 560
TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRER    561 - 630
SSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMR    631 - 700
MDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRND    701 - 770
MKKKAKLF                                                                  771 - 778
//

Text Mined References (40)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25403273 2015 ABLIM1 splicing is abnormal in skeletal muscle of patients with DM1 and regulated by MBNL, CELF and PTBP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21547531 2012 Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
More...