Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
periodontitis 269 8.2e-15
Atopic dermatitis 944 1.2e-05
diabetes mellitus 1663 1.5e-03
Disease Target Count Z-score Confidence
Irritant dermatitis 9 3.603 1.8
Xeroderma pigmentosum 41 3.413 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
periodontitis -1.100 8.2e-15
Atopic dermatitis -4.400 1.2e-05
diabetes mellitus 1.600 1.5e-03

Gene RIF (2)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV
11698679 XP5 is part of a cluster of genes (LEP genes) whose proteins incorporate into keratinocyte cornified envelopes. Strong skin expression confirmed.

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGG      1 - 70
CCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC                                   71 - 110
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9344646 1997 Positional cloning of novel skin-specific genes from the human epidermal differentiation complex.