Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
periodontitis -1.100 0.000
Atopic dermatitis -4.400 0.000
diabetes mellitus 1.600 0.002

Gene RIF (2)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV
11698679 XP5 is part of a cluster of genes (LEP genes) whose proteins incorporate into keratinocyte cornified envelopes. Strong skin expression confirmed.

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGG      1 - 70
CCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC                                   71 - 110
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9344646 1997 Positional cloning of novel skin-specific genes from the human epidermal differentiation complex.