Property Summary

NCBI Gene PubMed Count 17
Grant Count 35
R01 Count 19
Funding $2,745,717.07
PubMed Score 27.70
PubTator Score 17.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (4)

PMID Text
23038246 a molecular mechanisms through which increased expression of HoxA10 increases Cdx4 expression by direct CDX4 activation and by Fgf2-induced beta-catenin activity. This results in Cdx4-induced HoxA10-expression, creating a positive feedback mechanism
22721648 CDX4 gene was introduced to reprogram adipose tissue derived mesenchymal stem cells to differentiate along the hematopoietic lineage.
21518475 Expression of CDX1 and CDX4 is not correlated with the pathogenesis and relapse of adult ALL.
21471217 positive feedback relationship between HoxA10 and Cdx4, which potentially amplified the contribution of either transcription factor to the pathogenesis of AML.

AA Sequence

MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLG      1 - 70
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTD     71 - 140
AGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNL    141 - 210
GLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQV    211 - 280
IVSE                                                                      281 - 284
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23038246 2012 ?-Catenin activates the HOXA10 and CDX4 genes in myeloid progenitor cells.
22721648 2012 Ectopic expression of CDX4 in human mesenchymal stem cells does not affect HOX gene expression or induce hematopoietic reprogramming.
21518475 2011 [Expression and clinical significance of caudal type homeobox transcription factor-2 in adult acute lymphocytic leukemia].
21471217 2011 HoxA10 activates CDX4 transcription and Cdx4 activates HOXA10 transcription in myeloid cells.
19796250 2009 Hematopoietic development from human induced pluripotent stem cells.
19371634 2009 Cdx2 and the Brm-type SWI/SNF complex cooperatively regulate villin expression in gastrointestinal cells.
18371423 2008 BMP and Wnt specify hematopoietic fate by activation of the Cdx-Hox pathway.
18274620 2008 ParaHox genes in pancreatic cell cultures: effects on the insulin promoter regulation.
17881901 2007 HOX gene regulation in acute myeloid leukemia: CDX marks the spot?
More...