Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.11
PubTator Score 0.80

Knowledge Summary

Patent (1,931)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.59918106203151E-23
lung carcinoma 2844 5.11877174942974E-7
non-small cell lung cancer 2798 7.43036149501823E-7
lung cancer 4473 1.09584260974065E-4
tuberculosis and treatment for 6 months 686 5.50616968738224E-4
cutaneous lupus erythematosus 1056 5.90591114628645E-4
interstitial cystitis 2299 8.32170193570964E-4
ovarian cancer 8492 0.00117788190179917
Atopic dermatitis 944 0.00155647857737083
primary Sjogren syndrome 789 0.00237201902966368
osteosarcoma 7933 0.00302693874127281
acute myeloid leukemia 785 0.0288136787801417
gastric cancer 436 0.0290699671242961
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.048603909189505

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.100 0.029
cutaneous lupus erythematosus 2.700 0.001
osteosarcoma -2.412 0.003
Atopic dermatitis 1.500 0.002
tuberculosis and treatment for 6 months -2.200 0.001
non-small cell lung cancer -1.192 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.049
lung cancer -3.000 0.000
interstitial cystitis 2.400 0.001
primary Sjogren syndrome 1.400 0.002
lung carcinoma -1.400 0.000
acute myeloid leukemia -1.200 0.029
ovarian cancer -1.800 0.001
psoriasis 1.300 0.000

Synonym

Accession O14626 D3DNJ4 Q8IV06
Symbols H963

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

  TechDev Info (1)

AA Sequence

MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVK      1 - 70
IVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWL     71 - 140
MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNK    141 - 210
DNENYPNVKKALINILLVTTGYIICFVPYHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCF    211 - 280
DPILYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA                                   281 - 319
//

Text Mined References (7)

PMID Year Title
24043826 2013 GPR171 is a hypothalamic G protein-coupled receptor for BigLEN, a neuropeptide involved in feeding.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11524702 2001 Mutations in a novel gene with transmembrane domains underlie Usher syndrome type 3.
9370294 1997 A genetic selection for isolating cDNAs encoding secreted proteins.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.