Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.87
PubTator Score 0.80

Knowledge Summary

Patent (1,931)

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.200 2.9e-02
Atopic dermatitis 1.500 1.6e-03
cutaneous lupus erythematosus 2.700 5.9e-04
gastric cancer 1.100 2.9e-02
interstitial cystitis 2.400 8.3e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.9e-02
lung cancer -1.800 1.2e-02
lung carcinoma -1.400 5.1e-07
non-small cell lung cancer -1.192 7.4e-07
osteosarcoma -2.412 3.0e-03
ovarian cancer -1.800 1.2e-03
primary Sjogren syndrome 1.400 2.4e-03
psoriasis 1.300 2.6e-23
tuberculosis -1.200 3.2e-03

Gene RIF (1)

AA Sequence

MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVK      1 - 70
IVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWL     71 - 140
MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNK    141 - 210
DNENYPNVKKALINILLVTTGYIICFVPYHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCF    211 - 280
DPILYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA                                   281 - 319
//

Text Mined References (8)

PMID Year Title