Property Summary

NCBI Gene PubMed Count 102
PubMed Score 520.22
PubTator Score 334.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
interstitial cystitis 3.900 3.3e-02
active Crohn's disease 3.297 3.5e-03
active ulcerative colitis 2.738 4.4e-02
adult high grade glioma 2.100 3.6e-05
Breast cancer 2.100 1.5e-04
breast carcinoma 1.700 2.5e-22
colon cancer 2.600 2.9e-02
cutaneous lupus erythematosus 5.200 3.4e-04
cystic fibrosis 3.300 1.3e-02
ductal carcinoma in situ 2.000 4.8e-02
glioblastoma 1.500 6.2e-04
head and neck cancer 4.200 4.8e-04
head and neck cancer and chronic obstruc... 2.500 2.5e-02
intraductal papillary-mucinous adenoma (... -2.000 3.7e-03
invasive ductal carcinoma 1.457 3.3e-03
juvenile dermatomyositis 3.668 4.3e-11
lung cancer -1.200 3.6e-04
lung carcinoma -1.100 1.1e-03
medulloblastoma, large-cell 1.800 1.2e-02
nasopharyngeal carcinoma 4.000 9.8e-09
posterior fossa group A ependymoma 1.200 4.4e-03
primary Sjogren syndrome 2.200 6.9e-05
psoriasis 1.200 8.5e-04
sarcoidosis 3.200 1.8e-02
urothelial carcinoma -3.000 2.5e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (84)

AA Sequence

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK      1 - 70
GQRCLNPKSKQARLIIKKVERKNF                                                   71 - 94
//

Text Mined References (102)

PMID Year Title