Property Summary

NCBI Gene PubMed Count 90
Grant Count 140
R01 Count 60
Funding $13,076,500.67
PubMed Score 491.15
PubTator Score 334.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Synonym

Accession O14625 Q53YA3 Q92840
Symbols IP9
H174
IP-9
b-R1
I-TAC
SCYB11
SCYB9B

Gene

PDB

1RJT  

Gene RIF (72)

PMID Text
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26275808 higher concentration is associated with neutrophils accumulation in the alveolar space of Systemic Lupus Erythematosus patients with pulmonary fibrosis
26116899 HIV-1 Vpr upregulates the expression of CXCL11 in human monocyte-derived dendritic cells
25890876 Resveratrol substantially inhibited the proinflammatory cytokines-induced CXCL11 production while partially blocking nuclear factor-kappaB activation.
25858769 Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia.
25810367 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25605062 Cyclic stretch significantly induced ESC secretion of CXCL8 and CXCL1 and neutrophil chemotaxis. Stretch also increased MMP-1, MMP-2, and MMP-3 activity, activin A secretion, and activity in ESC.
25559603 The homozygosity for the CXCL9 rs10336 (T), CXCL10 rs3921 (G), and CXCL11 rs4619915 (A) alleles is associated with the higher likelihood of significant liver fibrosis in HIV-infected patients coinfected with hepatitis C virus genotype 1.
25251331 High CXCL11 expression is associated with acute cellular rejection.
More...

AA Sequence

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK      1 - 70
GQRCLNPKSKQARLIIKKVERKNF                                                   71 - 94
//

Text Mined References (90)

PMID Year Title
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26275808 2015 The Role of CXC Chemokines in Pulmonary Fibrosis of Systemic Lupus Erythematosus Patients.
25890876 2015 Resveratrol attenuates CXCL11 expression induced by proinflammatory cytokines in retinal pigment epithelial cells.
25858769 2015 Common variants of chemokine receptor gene CXCR3 and its ligands CXCL10 and CXCL11 associated with vascular permeability of dengue infection in peninsular Malaysia.
25810367 2015 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes of common marmoset and human.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25605062 2015 Cyclic stretch augments production of neutrophil chemokines, matrix metalloproteinases, and activin a in human endometrial stromal cells.
25559603 2015 Single nucleotide polymorphisms of CXCL9-11 chemokines are associated with liver fibrosis in HIV/HCV-coinfected patients.
25416956 2014 A proteome-scale map of the human interactome network.
25251331 2014 Immunosuppressive therapies after intestinal transplant modulate the expression of Th1 signature genes during acute cellular rejection. Implications in the search for rejection biomarkers.
More...