Property Summary

NCBI Gene PubMed Count 41
PubMed Score 50.67
PubTator Score 50.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.149 1.9e-04
ovarian cancer 1.700 5.0e-07
psoriasis 1.600 6.3e-04

Gene RIF (25)

AA Sequence

MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTG      1 - 70
RQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNN     71 - 140
CNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRG    141 - 210
GHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL          211 - 274
//

Text Mined References (45)

PMID Year Title