Property Summary

NCBI Gene PubMed Count 41
Grant Count 19
R01 Count 15
Funding $2,700,140.82
PubMed Score 49.54
PubTator Score 50.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.600 0.001
osteosarcoma -1.149 0.000
ovarian cancer 1.700 0.000

Gene RIF (25)

PMID Text
26745464 In addition to Atox1, the human cytoplasm also contains Cu chaperones for loading of superoxide dismutase 1 (i.e. CCS) and cytochrome c oxidase in mitochondria (i.e. Cox17). [review]
25673218 Human cytoplasmic copper chaperones Atox1 and CCS exchange copper ions in vitro
25429517 Coexpression of hCCS in the presence of copper restores the correct maturation of the SOD1 mutants and prevents the formation of the unstructured species, confirming that hCCS also acts as a molecular chaperone.
24855044 CCS mRNA and protein levels in the serum are not correlated with inflammatory processes.
24343031 CTR1 silencing increased the protein levels of copper chaperone ATOX1 and copper chaperone for superoxide dismutase 1 (CCS-1), but decreased copper chaperone for cytochrome c oxidase (COX17).
24297923 CCS-dependent copper acquisition and distribution largely occur at membrane interfaces and that this emerging role of the bilayer may reflect a general mechanistic aspect of cellular transition metal ion acquisition.
24026195 CCS1 serves as a specialized import receptor in mitochondria that facilitates the import and folding of SOD1 and CCS1.
23900152 CCS-1 facilitates copper trafficking to the mitochondria, but does not affect the transfer of copper to the cytochrome c oxidase.
22869735 analysis of human superoxide dismutase 1 (hSOD1) maturation through interaction with human copper chaperone for SOD1 (hCCS)
22508683 The CCS mutation, p.Arg163Trp, causes reduced SOD1 activity and may impair other mechanisms important for normal Cu homeostasis.
More...

AA Sequence

MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTG      1 - 70
RQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNN     71 - 140
CNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRG    141 - 210
GHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL          211 - 274
//

Text Mined References (45)

PMID Year Title
26745464 2016 Extended functional repertoire for human copper chaperones.
25673218 2015 Human cytoplasmic copper chaperones Atox1 and CCS exchange copper ions in vitro.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429517 2014 In-cell NMR reveals potential precursor of toxic species from SOD1 fALS mutants.
24855044 2014 CCS mRNA transcripts and serum CCS protein as copper marker in adults suffering inflammatory processes.
24343031 2014 Changes in copper concentrations affect the protein levels but not the mRNA levels of copper chaperones in human umbilical vein endothelial cells.
24297923 2013 Cellular distribution of copper to superoxide dismutase involves scaffolding by membranes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026195 2013 Human copper chaperone for superoxide dismutase 1 mediates its own oxidation-dependent import into mitochondria.
23900152 2013 Copper chaperone for superoxide dismutase-1 transfers copper to mitochondria but does not affect cytochrome c oxidase activity.
More...