Property Summary

NCBI Gene PubMed Count 34
PubMed Score 7.42
PubTator Score 5.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hermanski-Pudlak Syndrome 8 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 3.954 2.0
Disease Target Count Z-score Confidence
Anogenital venereal wart 14 3.158 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.8e-02
atypical teratoid / rhabdoid tumor -1.100 5.7e-03
medulloblastoma -1.100 4.4e-03
medulloblastoma, large-cell -1.700 1.6e-04
ovarian cancer -1.300 5.0e-04
psoriasis 1.600 5.1e-05
Rheumatoid arthritis 2.200 4.4e-04

 GO Function (1)

Pathway (1)

Gene RIF (26)

AA Sequence

MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQMLGY      1 - 70
DISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVT     71 - 140
PDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICEL    141 - 210
ARRNPKNYLSLAPLFFKLMTSSTNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECV    211 - 280
NTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLD    281 - 350
DKDESIRLRALDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYIS    351 - 420
ILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICG    421 - 490
EFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQF    491 - 560
VQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEP    561 - 630
LSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVE    631 - 700
HIPVVQIDLSVPLKVPGLPMSDQYVKLEEERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESDEDIAP    701 - 770
AQQVDIVTEEMPENALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPIQKHRNTETSKSPEKDVPMVEKK    771 - 840
SKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEEAAGEPVQNGA    841 - 910
PEEEQLPPESSYSLLAENSYVKMTCDIRGSLQEDSQVTVAIVLENRSSSILKGMELSVLDSLNARMARPQ    911 - 980
GSSVHDGVPVPFQLPPGVSNEAQYVFTIQSIVMAQKLKGTLSFIAKNDEGATHEKLDFRLHFSCSSYLIT    981 - 1050
TPCYSDAFAKLLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRSIQGHHVCLLV   1051 - 1120
KKGENSVSVDGKCSDSTLLSNLLEEMKATLAKC                                        1121 - 1153
//

Text Mined References (42)

PMID Year Title