Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.57
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 17 7 4.329 2.2
Cone dystrophy 71 3.239 1.6
CLL/SLL 2 3.145 1.6

Expression

Synonym

Accession O14610 B2R746 D3DTW5
Symbols GNG8
GNG9
GNGT8
G-GAMMA-8
G-GAMMA-C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS       1 - 69
//

Text Mined References (17)

PMID Year Title