Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.36
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Male breast cancer 1 3.249 1.6

Expression

Synonym

Accession O14604 Q0VDA2
Symbols TB4Y

Gene

Gene RIF (2)

PMID Text
19369144 T beta 4 is a key activator of NK cell cytotoxicity.
15557202 TMSB4Y has been found to encode a novel HLA-A*3303-restricted minor histocompatibility H-Y antigen, revealed during cytotoxicity assays of T cell lines from a female-to-male hemopoietic stem cell transplantation patient.

AA Sequence

MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES                                1 - 44
//

Text Mined References (11)

PMID Year Title
26702755 2015 TMSB4Y is a candidate tumor suppressor on the Y chromosome and is deleted in male breast cancer.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19369144 2009 Thymosin beta 4 enhances NK cell cytotoxicity mediated by ICAM-1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15557202 2004 A novel HLA-A*3303-restricted minor histocompatibility antigen encoded by an unconventional open reading frame of human TMSB4Y gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
9381176 1997 Functional coherence of the human Y chromosome.
More...