Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.36
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Male breast cancer 2 3.235 1.6

Expression

Gene RIF (3)

AA Sequence

MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES                                1 - 44
//

Text Mined References (11)

PMID Year Title