Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.55
PubTator Score 13.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24319994 The N-terminal tail of eIF1A mediates the interaction with eIF5 and eIF1.
19605777 investigated 12 single-nucleotide polymorphisms in Y-linked neuroligin 4, transducin b-like 1, and eukaryotic translation initiation factor 1a genes, results suggest a Y chromosome effect in autism
19605777 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVW      1 - 70
INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDED     71 - 140
IDDI                                                                      141 - 144
//

Text Mined References (19)

PMID Year Title
24319994 2013 The interaction between eukaryotic initiation factor 1A and eIF5 retains eIF1 within scanning preinitiation complexes.
22365286 2012 Y chromosome gene expression in the blood of male patients with ischemic stroke compared with male controls.
22158087 2012 HSFY genes and the P4 palindrome in the AZFb interval of the human Y chromosome are not required for spermatocyte maturation.
20823116 2010 H-Y antibody titers are increased in unexplained secondary recurrent miscarriage patients and associated with low male : female ratio in subsequent live births.
20031959 2010 The gene expression profile of patients with new-onset heart failure reveals important gender-specific differences.
19605777 2009 Association of Y chromosome haplotypes with autism.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16936303 2007 Expression profile of AZF genes in testicular biopsies of azoospermic men.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15613541 2005 Antibody responses to H-Y minor histocompatibility antigens correlate with chronic graft-versus-host disease and disease remission.
More...