Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.39
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (5)

PMID Text
24935076 genetic association study in Chinese population: Data suggest that combined patterns of copy number abnormality in BPY2 (basic charge Y-linked protein 2) and/or DAZ1 (deleted in azoospermia 1) are associated with spermatogenic impairment/azoospermia.
20039973 Observational study of gene-disease association. (HuGE Navigator)
17511727 Observational study of gene-disease association. (HuGE Navigator)
12724276 VCY2 was weakly expressed at the spermatogonia and immunonegative in spermatocytes and round spermatids in testicular biopsy specimens with maturation arrest or hypospermatogenesis.
12207887 VCY2 protein interacts with the HECT domain of ubiquitin-protein ligase E3A

AA Sequence

MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLT      1 - 70
YYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK                                       71 - 106
//

Text Mined References (11)

PMID Year Title
26162009 2015 Isoform-Level Gene Expression Profiles of Human Y Chromosome Azoospermia Factor Genes and Their X Chromosome Paralogs in the Testicular Tissue of Non-Obstructive Azoospermia Patients.
24935076 2014 Gene copy number alterations in the azoospermia-associated AZFc region and their effect on spermatogenic impairment.
20039973 2010 Differential effect of specific gr/gr deletion subtypes on spermatogenesis in the Chinese Han population.
17511727 2007 Alu sequence variants of the BPY2 gene in proven fertile and infertile men with Sertoli cell-only phenotype.
15177557 2004 A family of human Y chromosomes has dispersed throughout northern Eurasia despite a 1.8-Mb deletion in the azoospermia factor c region.
14627543 2004 Identification and characterization of human VCY2-interacting protein: VCY2IP-1, a microtubule-associated protein-like protein.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12724276 2003 Specific expression of VCY2 in human male germ cells and its involvement in the pathogenesis of male infertility.
12207887 2002 VCY2 protein interacts with the HECT domain of ubiquitin-protein ligase E3A.
9847074 1998 Toward a complete human genome sequence.
More...