Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.95
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
24970476 Identified members of the VCX/Y gene family as novel CT antigens.
17342728 Human VCX/Y, SPANX, and CSAG2 gene families together with the murine SPANX gene and the CYPT family may share a common ancestor.

AA Sequence

MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP                    71 - 125
//

Text Mined References (8)

PMID Year Title
24970476 2014 A search for novel cancer/testis antigens in lung cancer identifies VCX/Y genes, expanding the repertoire of potential immunotherapeutic targets.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10607842 2000 A human sex-chromosomal gene family expressed in male germ cells and encoding variably charged proteins.
9847074 1998 Toward a complete human genome sequence.
9381176 1997 Functional coherence of the human Y chromosome.