Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.02
PubTator Score 6.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Synonym

Accession O14598
Symbols BPY1
VCY1
VCY1A

Gene

VCY

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP                    71 - 125
//

Text Mined References (8)

PMID Year Title