Property Summary

NCBI Gene PubMed Count 15
PubMed Score 50.15
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.25871751980234E-9
tuberculosis 1563 1.00451686553329E-7
atypical teratoid / rhabdoid tumor 4369 4.2745822802021E-6
glioblastoma 5572 1.19530632391984E-5
astrocytoma 1493 0.00108272059193014
adult high grade glioma 2148 0.00142171597428155
Pick disease 1893 0.00389699571756463
progressive supranuclear palsy 674 0.0204262745513072

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.400 0.001
glioblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
tuberculosis -1.600 0.000
adult high grade glioma 1.400 0.001
Pick disease 1.100 0.004
progressive supranuclear palsy 1.400 0.020
ovarian cancer -1.500 0.000

Synonym

Accession O14595 A8K5H4 Q53ZR2 Q6NZY3 Q9UEX1
Symbols OS4
PSR2
SCP2

Gene

PDB

2Q5E  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25990325 CTDSP2 induces p21(Cip1/Waf1) through increasing the activity of Ras.
17085434 SCP2 acts as a phosphatase for regulatory phosphorylations in the linker region of Smad1 and Smad2
16724108 These results suggest that SCP2 is involved in promoter clearance during steroid-activated transcription.

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIA      1 - 70
KSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYV     71 - 140
LKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDL    141 - 210
RKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP             211 - 271
//

Text Mined References (19)

PMID Year Title
25990325 2015 FOXO target gene CTDSP2 regulates cell cycle progression through Ras and p21(Cip1/Waf1).
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
18058037 2007 Structural genomics of protein phosphatases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17085434 2006 Dephosphorylation of the linker regions of Smad1 and Smad2/3 by small C-terminal domain phosphatases has distinct outcomes for bone morphogenetic protein and transforming growth factor-beta pathways.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16724108 2006 Small carboxyl-terminal domain phosphatase 2 attenuates androgen-dependent transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...