Property Summary

NCBI Gene PubMed Count 16
PubMed Score 52.07
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.300 4.2e-03
astrocytic glioma 1.100 3.9e-02
atypical teratoid / rhabdoid tumor 1.100 4.3e-06
glioblastoma 1.600 1.2e-05
ovarian cancer -1.500 3.3e-09
Pick disease 1.100 3.9e-03
progressive supranuclear palsy 1.400 2.0e-02
tuberculosis -1.100 5.3e-06

Gene RIF (3)

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIA      1 - 70
KSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYV     71 - 140
LKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDL    141 - 210
RKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP             211 - 271
//

Text Mined References (20)

PMID Year Title