Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $235,134.6
PubMed Score 50.15
PubTator Score 6.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.400 0.001
glioblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
tuberculosis -1.600 0.000
adult high grade glioma 1.400 0.001
Pick disease 1.100 0.004
progressive supranuclear palsy 1.400 0.020
ovarian cancer -1.500 0.000

Synonym

Accession O14595 A8K5H4 Q53ZR2 Q6NZY3 Q9UEX1
Symbols OS4
PSR2
SCP2

Gene

PDB

2Q5E  

Gene RIF (3)

PMID Text
25990325 CTDSP2 induces p21(Cip1/Waf1) through increasing the activity of Ras.
17085434 SCP2 acts as a phosphatase for regulatory phosphorylations in the linker region of Smad1 and Smad2
16724108 These results suggest that SCP2 is involved in promoter clearance during steroid-activated transcription.

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIA      1 - 70
KSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYV     71 - 140
LKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDL    141 - 210
RKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP             211 - 271
//

Text Mined References (19)

PMID Year Title
25990325 2015 FOXO target gene CTDSP2 regulates cell cycle progression through Ras and p21(Cip1/Waf1).
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
18058037 2007 Structural genomics of protein phosphatases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17085434 2006 Dephosphorylation of the linker regions of Smad1 and Smad2/3 by small C-terminal domain phosphatases has distinct outcomes for bone morphogenetic protein and transforming growth factor-beta pathways.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16724108 2006 Small carboxyl-terminal domain phosphatase 2 attenuates androgen-dependent transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...