Property Summary

NCBI Gene PubMed Count 37
Grant Count 65
R01 Count 30
Funding $7,826,473.39
PubMed Score 145.42
PubTator Score 25.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.300 0.006
group 3 medulloblastoma -1.500 0.016
Pick disease -1.400 0.010
pituitary cancer 1.900 0.000

Synonym

Accession O14594 Q9UPK6
Symbols CSPG3

Gene

Gene RIF (17)

PMID Text
26758378 This study aims to analyze the influences of single-nucleotide polymorphism in the NCAN-CILP2 region on non-alcoholic fatty liver disease and plasma lipid levels in the Asian and Pacific ethnic groups.
25801500 NCAN genotype is associated with limbic gray matter alterations in healthy and subjects with major depression in brain areas implicated in emotion perception and regulation
25220293 current data demonstrate that common genetic variation in NCAN influences both neural processing and cognitive performance in healthy subjects.
24978903 Conditional analysis shows that a neighbouring gene, TM6SF2, not NCAN, is responsible for the Chr 19 GWAS locus previously associated with fibrosing non-alcoholic fatty liver disease (NAFLD).
24946282 The frequency of the NCAN rs2228603 T allele was significantly increased in patients with HCC due to ALD (15.1%) compared to alcoholic cirrhosis without HCC (9.3%), alcoholic controls (7.2%), healthy controls (7.9%), and HCV associated HCC (9.1%).
23795679 NCAN risk variant is associated with cortical folding and thickness in bipolar disorder and schizophrenia.
23594525 NCAN rs2228603[T] is a risk factor for liver inflammation and fibrosis, suggesting that this locus is responsible for progression from steatosis to steatohepatitis.
23198940 no genetic association between risk allele A for NCAN locus rs1064395 and schizophrenia.
22952076 In the combined patient sample, the NCAN risk allele was significantly associated with the "mania" factor, in particular the subdimension "overactivity.
22497794 The rs1064395 A-allele was significantly over-represented in schizophrenia patients compared to controls. Our data suggest that genetic variation in NCAN is a common risk factor for bipolar disorder and schizophrenia.
More...

AA Sequence

MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAA      1 - 70
RDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRC     71 - 140
QVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQEACRLSSAIIAAPRHLQAAFEDGFDNCDAGW    141 - 210
LSDRTVRYPITQSRPGCYGDRSSLPGVRSYGRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQC    211 - 280
RRQGAALASVGQLHLAWHEGLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAER    281 - 350
FDAYCFRAHHPTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE    351 - 420
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRRGRFKGLNGRY    421 - 490
FQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSPWADLTNEVDMPGAGSAGGKS    491 - 560
SPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATPDLFWSPLEATVSAPSPAPWEAFPVATSPDL    561 - 630
PMMAMLRGPKEWMLPHPTPISTEANRVEAHGEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPES    631 - 700
PRADFRETGETSPAQVNKAEHSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSG    701 - 770
LQATVDEVQDPWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA    771 - 840
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPEPEDQVETQGT    841 - 910
SGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLLPVTLGIEDFELEVLAGSPGV    911 - 980
ESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDC    981 - 1050
LCSPCENGGTCIDEVNGFVCLCLPSYGGSFCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRS   1051 - 1120
GHLTSVHSPEEHSFINSFGHENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAH   1121 - 1190
ESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS   1191 - 1260
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNFC            1261 - 1321
//

Text Mined References (38)

PMID Year Title
26758378 2016 Replication analysis of genetic association of the NCAN-CILP2 region with plasma lipid levels and non-alcoholic fatty liver disease in Asian and Pacific ethnic groups.
25801500 2015 NCAN Cross-Disorder Risk Variant Is Associated With Limbic Gray Matter Deficits in Healthy Subjects and Major Depression.
25220293 2015 A genome-wide supported psychiatric risk variant in NCAN influences brain function and cognitive performance in healthy subjects.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24978903 2014 TM6SF2 rs58542926 influences hepatic fibrosis progression in patients with non-alcoholic fatty liver disease.
24946282 2014 A common polymorphism in the NCAN gene is associated with hepatocellular carcinoma in alcoholic liver disease.
24618891 2014 Genome-wide association study reveals two new risk loci for bipolar disorder.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23795679 2014 Common variation in NCAN, a risk factor for bipolar disorder and schizophrenia, influences local cortical folding in schizophrenia.
23594525 2013 Genetic variation at NCAN locus is associated with inflammation and fibrosis in non-alcoholic fatty liver disease in morbid obesity.
More...