Property Summary

NCBI Gene PubMed Count 19
PubMed Score 702.60
PubTator Score 26.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Bare lymphocyte syndrome 2 4 0.0 0.0
Disease Target Count P-value
glioblastoma multiforme 142 1.8e-24
ovarian cancer 8520 3.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
MHC class II deficiency 6 0.0 5.0
Disease Target Count Z-score Confidence
Severe combined immunodeficiency 51 3.604 1.8
Disease Target Count
Bare Lymphocyte Syndrome, Type 2 4

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma multiforme 1.100 1.8e-24
ovarian cancer 1.200 3.1e-04

Gene RIF (8)

AA Sequence

MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHS      1 - 70
TTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETV     71 - 140
RFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALL    141 - 210
ARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE                        211 - 260
//

Text Mined References (23)

PMID Year Title