Property Summary

NCBI Gene PubMed Count 32
PubMed Score 5.91
PubTator Score 6.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
astrocytic glioma -2.700 0.001
ependymoma -3.000 0.000
oligodendroglioma -2.200 0.013
psoriasis -1.100 0.000
cutaneous lupus erythematosus -1.400 0.006
glioblastoma -2.900 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -2.200 0.009
adrenocortical carcinoma 1.339 0.029
non-small cell lung cancer 1.206 0.000
lung cancer 4.100 0.000
colon cancer -2.600 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -1.656 0.048
Breast cancer 1.100 0.033
lung carcinoma 3.200 0.000
Pick disease -1.800 0.005

Synonym

Accession O14576 B4DME3 F5H050 G5E9K1 Q8TBF7 Q9Y2X1
Symbols DNCI1
DNCIC1

Gene

Gene RIF (11)

PMID Text
25818806 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
25231297 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
25231166 Deletions of the exons with regulatory potential of DYNC1I1 are an example of the emerging role of exonic enhancer elements and their implications in congenital malformation syndromes
25015291 SQSTM1 is required for proper dynein motility and trafficking along microtubules.
24459211 Genome sequencing of the deletion breakpoints showed that the DLX5 and DLX6 genes are disomic but the putative DYNC1I1 exon 15 and 17 enhancers are deleted.
23960070 NCAM and dynein have roles in tethering dynamic microtubules and maintaining synaptic density in cortical neurons
21767414 the mRNA expression level of DYNC1I1 were significantly up-regulated in tumorous liver tissues compared with corresponding nontumorous counterparts.
21763495 Both P-TEFb recruitment to the HIV long terminal repeat and enhanced HIV processivity were blocked by ERK inhibitor, but not by AKT and PI3K inhibitors.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20048338 NDE1 and NDEL1 act upstream of LIS1 in dynein recruitment, and/or activation, on the membrane.
More...

AA Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP      1 - 70
EPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSE     71 - 140
LGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKE    141 - 210
APPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFY    211 - 280
DEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFAR    281 - 350
FHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL    351 - 420
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGI    421 - 490
NCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLW    491 - 560
NLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRA    561 - 630
NRADSEEEGTVELSA                                                           631 - 645
//

Text Mined References (35)

PMID Year Title
25540360 2015 Circovirus transport proceeds via direct interaction of the cytoplasmic dynein IC1 subunit with the viral capsid protein.
25231166 2014 Deletions of exons with regulatory activity at the DYNC1I1 locus are associated with split-hand/split-foot malformation: array CGH screening of 134 unrelated families.
25015291 2014 Interaction of SQSTM1 with the motor protein dynein--SQSTM1 is required for normal dynein function and trafficking.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
24459211 2014 Next generation sequencing of chromosomal rearrangements in patients with split-hand/split-foot malformation provides evidence for DYNC1I1 exonic enhancers of DLX5/6 expression in humans.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23960070 2013 Dynein interacts with the neural cell adhesion molecule (NCAM180) to tether dynamic microtubules and maintain synaptic density in cortical neurons.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
More...