Property Summary

NCBI Gene PubMed Count 32
PubMed Score 5.97
PubTator Score 6.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.339 2.9e-02
adult high grade glioma -2.700 7.6e-06
astrocytic glioma -2.700 1.2e-03
Astrocytoma, Pilocytic -2.700 1.8e-09
atypical teratoid / rhabdoid tumor -3.900 1.1e-10
Breast cancer 1.100 3.3e-02
colon cancer -2.600 3.7e-04
cutaneous lupus erythematosus -1.400 5.6e-03
ependymoma -2.600 1.3e-02
glioblastoma -2.900 8.5e-09
group 3 medulloblastoma -1.100 7.3e-03
lung cancer 1.400 7.6e-03
lung carcinoma 3.200 2.1e-40
malignant mesothelioma 1.900 8.5e-08
medulloblastoma, large-cell -2.700 9.8e-05
non-small cell lung cancer 1.206 1.2e-07
oligodendroglioma -2.200 1.3e-02
Pick disease -1.800 5.2e-03
primitive neuroectodermal tumor -2.200 9.0e-03
psoriasis -1.100 2.6e-08
subependymal giant cell astrocytoma -1.656 4.8e-02

Gene RIF (11)

AA Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP      1 - 70
EPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSE     71 - 140
LGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKE    141 - 210
APPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFY    211 - 280
DEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFAR    281 - 350
FHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL    351 - 420
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGI    421 - 490
NCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLW    491 - 560
NLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRA    561 - 630
NRADSEEEGTVELSA                                                           631 - 645
//

Text Mined References (36)

PMID Year Title