Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.88
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.520 7.6e-04
psoriasis 1.600 1.1e-03

Gene RIF (1)

AA Sequence

MALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMTEALLVFSPE      1 - 70
SSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLVTRHGQAGLLAVLWAGLQCSGGVG     71 - 140
LLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCSLWFTASVTGAAWYLAVLCPVLTSLVIMNQV    141 - 210
SNAYLYRKRIQP                                                              211 - 222
//

Text Mined References (13)

PMID Year Title