Property Summary

NCBI Gene PubMed Count 11
Grant Count 6
R01 Count 4
Funding $201,379
PubMed Score 6.88
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.600 0.001
pancreatic ductal adenocarcinoma liver m... -1.520 0.001

Gene RIF (1)

PMID Text
19734123 The protein exhibits the characteristics typical of members of the cytochrome b561 family, being a hydrophobic, transmembrane heme protein. It is capable of oxidation-reduction reaction and is a candidate tumor suppressor gene product.

AA Sequence

MALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMTEALLVFSPE      1 - 70
SSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLVTRHGQAGLLAVLWAGLQCSGGVG     71 - 140
LLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCSLWFTASVTGAAWYLAVLCPVLTSLVIMNQV    141 - 210
SNAYLYRKRIQP                                                              211 - 222
//

Text Mined References (13)

PMID Year Title
23249217 2013 Cytochromes b561: ascorbate-mediated trans-membrane electron transport.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19734123 2008 Functional expression and characterization of human 101F6 protein, a homologue of cytochrome b561 and a candidate tumor suppressor gene product.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...