Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 7.10393572681044E-24
Breast cancer 3099 1.14924764130243E-16
lung adenocarcinoma 2714 4.04690578310557E-9
malignant mesothelioma 3163 2.00835732944398E-6
lung cancer 4473 2.07941685021995E-5
medulloblastoma, large-cell 6234 4.74868540314116E-5
ovarian cancer 8492 3.18593405546239E-4
atypical teratoid / rhabdoid tumor 4369 3.48290483819131E-4
cutaneous lupus erythematosus 1056 0.00245499474162542
invasive ductal carcinoma 2950 0.00332923255408239
active Crohn's disease 918 0.00663364047518914

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
cutaneous lupus erythematosus 1.400 0.002
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.459 0.000
lung cancer 2.300 0.000
active Crohn's disease 1.073 0.007
lung adenocarcinoma 1.100 0.000
Breast cancer 1.400 0.000
invasive ductal carcinoma 1.100 0.003
ovarian cancer 1.400 0.000

Synonym

Accession O14562 A8MW58 D3DWF2
Symbols UBPH

Gene

  Ortholog (9)

AA Sequence

MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQAS      1 - 70
VSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLR     71 - 140
EIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQ    141 - 210
ERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPT    211 - 280
EASYYWVYWVPTQYVDAIKDTVLGKWQYF                                             281 - 309
//

Text Mined References (9)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19285159 2009 Identification of polyubiquitin binding proteins involved in NF-kappaB signaling using protein arrays.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.