Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.073 6.6e-03
atypical teratoid / rhabdoid tumor 1.300 3.5e-04
Breast cancer 1.400 1.1e-16
cutaneous lupus erythematosus 1.400 2.5e-03
invasive ductal carcinoma 1.100 3.3e-03
lung adenocarcinoma 1.100 4.0e-09
lung cancer 1.300 1.5e-02
malignant mesothelioma 1.200 2.0e-06
medulloblastoma, large-cell 1.200 4.7e-05
non-small cell lung cancer 1.459 7.1e-24
ovarian cancer 1.400 3.2e-04

AA Sequence

MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQAS      1 - 70
VSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLR     71 - 140
EIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQ    141 - 210
ERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPT    211 - 280
EASYYWVYWVPTQYVDAIKDTVLGKWQYF                                             281 - 309
//

Text Mined References (9)

PMID Year Title