Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
cutaneous lupus erythematosus 1.400 0.002
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.459 0.000
lung cancer 2.300 0.000
active Crohn's disease 1.073 0.007
lung adenocarcinoma 1.100 0.000
Breast cancer 1.400 0.000
invasive ductal carcinoma 1.100 0.003
ovarian cancer 1.400 0.000

AA Sequence

MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQAS      1 - 70
VSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLR     71 - 140
EIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQ    141 - 210
ERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPT    211 - 280
EASYYWVYWVPTQYVDAIKDTVLGKWQYF                                             281 - 309
//

Text Mined References (9)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19285159 2009 Identification of polyubiquitin binding proteins involved in NF-kappaB signaling using protein arrays.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.