Property Summary

NCBI Gene PubMed Count 18
Grant Count 50
R01 Count 32
Funding $15,930,644.74
PubMed Score 453.82
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.098 0.001
astrocytoma -1.200 0.002
pancreatic ductal adenocarcinoma liver m... -1.325 0.018
lung cancer 1.100 0.000
acute myeloid leukemia -1.100 0.003
ovarian cancer 1.200 0.002

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19221180 ACP has a dual role in mammalian mitochondrial function
18977241 Observational study of gene-disease association. (HuGE Navigator)
18230186 The p49/STRAP and NDUFAB1 proteins interacted and co-localized with each other in the cell.
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSD      1 - 70
MPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMC     71 - 140
PQEIVDYIADKKDVYE                                                          141 - 156
//

Text Mined References (23)

PMID Year Title
27499296 2016 Mitochondrial Protein Interaction Mapping Identifies Regulators of Respiratory Chain Function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21846720 2011 Mammalian ACSF3 protein is a malonyl-CoA synthetase that supplies the chain extender units for mitochondrial fatty acid synthesis.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19221180 2009 Down-regulation of mitochondrial acyl carrier protein in mammalian cells compromises protein lipoylation and respiratory complex I and results in cell death.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
More...