Property Summary

Ligand Count 1
NCBI Gene PubMed Count 19
PubMed Score 475.15
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.100 2.8e-03
astrocytoma -1.200 2.1e-03
lung cancer 1.100 2.6e-04
Multiple myeloma 1.098 1.3e-03
ovarian cancer 1.200 1.8e-03
pancreatic ductal adenocarcinoma liver m... -1.325 1.8e-02

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSD      1 - 70
MPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMC     71 - 140
PQEIVDYIADKKDVYE                                                          141 - 156
//

Text Mined References (24)

PMID Year Title