Property Summary

NCBI Gene PubMed Count 39
Grant Count 63
R01 Count 46
Funding $9,413,931.88
PubMed Score 222.06
PubTator Score 97.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 3.200 0.000
psoriasis -1.600 0.004
group 3 medulloblastoma -2.000 0.011
atypical teratoid / rhabdoid tumor 1.800 0.005
glioblastoma 1.600 0.002
medulloblastoma, large-cell 1.600 0.000
acute quadriplegic myopathy -1.367 0.001
primary pancreatic ductal adenocarcinoma 1.595 0.017
non-small cell lung cancer -1.618 0.000
colon cancer -4.000 0.000
lung cancer -2.900 0.000
adult high grade glioma 1.600 0.003
invasive ductal carcinoma -4.000 0.001
Polycystic Ovary Syndrome -1.025 0.031
breast carcinoma -1.300 0.000
ductal carcinoma in situ -2.600 0.001
ovarian cancer 1.800 0.000
Gaucher disease type 3 1.400 0.019
pancreatic cancer 1.300 0.009
dermatomyositis -2.900 0.000

Synonym

Accession O14558 O14551 Q6NVI3 Q96MG9 HspB6
Symbols HEL55
Hsp20
PPP1R91

Gene

PANTHER Protein Class (1)

PDB

4JUS   4JUT  

Gene RIF (29)

PMID Text
27046040 findings strongly suggest that phosphorylated HSP20 inhibits TGF-alpha-induced HCC cell migration and invasion via suppression of the JNK signaling pathway
26694816 multiple sclerosis lesions revealed exclusive induction of HSPB6 in astrocytes, as confirmed by co-localization of HSPB6 with GFAP.
25965061 N-terminal mutations increase stability of large HspB1 homooligomers, prevent their phosphorylation-dependent dissociation, modulate their interaction with HspB6 and decrease their chaperoning capacity, preventing normal functioning of HspB1.
25447820 These findings strongly suggest that HSP20 might decrease the IKK-alpha protein level and that it down-regulates the TNF-alpha-stimulated intracellular signaling in HCC, thus resulting in the suppression of HCC progression.
25423708 HSP20 may play a protective role against the progression of ovarian cancer.
25332102 peptides in heat-shock protein Hsp20 (G71HFSVLLDVKHFSPEEIAVK91) and Hsp27 (D93RWRVSLDVNHFAPDELTVK113) with sequence homology to alpha-crystallin also have robust chaperone and anti-apoptotic activities.
25187324 Data suggest that heat shock protein 20 (HSP20) may have value as a prognostic tumor marker and its overexpression might be a novel strategy for colorectal cancer (CRC) therapy.
24969689 Findings strongly suggest that HSP20 directly associates with Bax and stimulates caspase cascade in human hepatocellular carcinoma cells.
24223153 HSP20 directly associates with PI3K subunits and suppresses its activity in hepatocellular carcinoma, resulting in the inhibition of the AKT pathway, and subsequently decreasing the growth of hepatocellular carcinoma.
22794279 14-3-3zeta and possibly other 14-3-3 isoforms may have additional functional roles conducted by the monomeric state
More...

AA Sequence

MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTD      1 - 70
PGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEG     71 - 140
VLSIQAAPASAQAPPPAAAK                                                      141 - 160
//

Text Mined References (40)

PMID Year Title
27046040 2016 Phosphorylated Heat Shock Protein 20 (HSPB6) Regulates Transforming Growth Factor-?-Induced Migration and Invasion of Hepatocellular Carcinoma Cells.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
25965061 2015 Characterization of Mutants of Human Small Heat Shock Protein HspB1 Carrying Replacements in the N-Terminal Domain and Associated with Hereditary Motor Neuron Diseases.
25447820 2015 Heat shock protein 20 (HSPB6) regulates TNF-?-induced intracellular signaling pathway in human hepatocellular carcinoma cells.
25423708 2014 Expression of heat shock protein 20 inversely correlated with tumor progression in patients with ovarian cancer.
25332102 2015 Identification of peptides in human Hsp20 and Hsp27 that possess molecular chaperone and anti-apoptotic activities.
25187324 2015 Decreased expression of heat shock protein 20 in colorectal cancer and its implication in tumorigenesis.
24969689 2014 Heat shock protein 20 (HSPB6) regulates apoptosis in human hepatocellular carcinoma cells: Direct association with Bax.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223153 2013 Direct association of heat shock protein 20 (HSPB6) with phosphoinositide 3-kinase (PI3K) in human hepatocellular carcinoma: regulation of the PI3K activity.
More...