Property Summary

NCBI Gene PubMed Count 41
PubMed Score 237.77
PubTator Score 97.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy -1.367 1.2e-03
adult high grade glioma 1.600 2.6e-03
atypical teratoid / rhabdoid tumor 1.800 4.7e-03
breast carcinoma -1.300 4.1e-10
colon cancer -1.100 4.6e-02
dermatomyositis -2.900 4.1e-04
ductal carcinoma in situ -2.400 9.0e-04
Gaucher disease type 3 1.400 1.9e-02
glioblastoma 1.600 2.2e-03
group 3 medulloblastoma -2.000 1.1e-02
invasive ductal carcinoma -1.758 3.2e-03
lung cancer -2.600 4.3e-06
malignant mesothelioma 3.200 5.1e-09
medulloblastoma, large-cell 1.600 3.0e-05
non-small cell lung cancer -1.102 9.2e-16
ovarian cancer 1.800 2.7e-11
pancreatic cancer 1.300 8.8e-03
Polycystic ovary syndrome -1.025 3.1e-02
primary pancreatic ductal adenocarcinoma 1.595 1.7e-02
psoriasis -1.600 3.8e-03

Gene RIF (31)

AA Sequence

MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTD      1 - 70
PGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEG     71 - 140
VLSIQAAPASAQAPPPAAAK                                                      141 - 160
//

Text Mined References (51)

PMID Year Title